KEGG   Mus musculus (mouse): 234912Help
Entry
234912            CDS       T01002                                 

Gene name
Cfap300, 9230110C19Rik
Definition
(RefSeq) cilia and flagella associated protein 300
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4498
Motif
Other DBs
NCBI-GeneID: 234912
NCBI-ProteinID: NP_950182
MGI: 3045346
Ensembl: ENSMUSG00000053070
Vega: OTTMUSG00000062311
UniProt: Q8CC70
Position
9; 9 A1
AA seq 267 aa AA seqDB search
MAAGEPRDGGGYYFRFLPHRTFSSLSAREITSRLRQWSMLGRIQAQAFSFDQTFQPYQKD
DFVMAFFKDPNVIPNLQLLSDSSGQWTTLGSEVKKIEAINVPCTQLSMSFFQRLYDENIV
RESGHIVKCLDSFCDPFLISDELRKVLLMEDSEKYEVFSPVEREEFLFCLFKHLCLGGSL
CQYEDVLKPYLETAKLIYKDLVSVRKHPRTKEIQITSSVFKVKAYDSVGVCYPSPKEHEQ
TFSYFVVDPIKRHVNVLYHCYGVGHMA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcggctggggagccacgggatggaggcggctactacttcagattcctgcctcataga
accttctcgtcgctgagcgcccgggagatcaccagccgcctccgccagtggtccatgctg
ggcagaatccaggcgcaggcgttcagcttcgaccagacgttccagccctaccaaaaggat
gattttgtcatggcttttttcaaagacccaaatgttattccaaatttgcagttactctca
gattcttctggacagtggaccacattaggatctgaagtgaaaaaaattgaagctataaat
gttccatgcacacaactttcaatgtcatttttccaacgcttatacgatgaaaatattgta
cgagaaagtggacacattgtcaaatgcctagattctttctgtgatccgtttctcatttca
gacgaactgagaaaagttttgctcatggaagactctgaaaaatatgaagtctttagccca
gtggaaagggaagagtttctgttctgtctttttaagcatctctgcctcggagggtccctt
tgtcagtatgaagatgtgctaaagccatatctggagacagctaagctgatctataaggat
ctggtgagtgttcggaaacatcctcgaaccaaggaaatacaaattacctcttctgtcttt
aaagtaaaagcctacgactctgttggtgtgtgctacccttcacctaaagagcatgagcag
acattctcgtattttgttgtggaccccatcaagcgtcatgtgaatgtcctgtaccactgc
tatggtgtagggcacatggcttag

DBGET integrated database retrieval system