KEGG   Mus musculus (house mouse): 235044
Entry
235044            CDS       T01002                                 
Symbol
Plppr2, Lppr2, PRG-4
Name
(RefSeq) phospholipid phosphatase related 2
  KO
K19581  lipid phosphate phosphatase-related protein type 1/2/5
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99983 Lipid metabolism
    235044 (Plppr2)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 235044
NCBI-ProteinID: NP_659184
MGI: 2384575
Ensembl: ENSMUSG00000040563
UniProt: Q8VCY8
Position
9:21846980..21860203
AA seq 343 aa
MAGGRPHLKRSFSIIPCFVFVESVLLGIVVLLAYRLEFTDTFPVHTQGFFCYDSAYAKPY
PGPEAASRAPPALIYALVTAGPTLTILLGELARAFFPAPPSSSPVSGESTIVSGACCRFS
PPLRRLVRFLGVYSFGLFTTTIFANAGQVVTGNPTPHFLSVCRPNYTALGCPPPSPDRPG
PDRFVTDQSACAGSPSLVAAARRAFPCKDAALCAYAVTYTAMYVTLVFRVKGSRLVKPSL
CLALLCPAFLVGVVRVAEYRNHWSDVLAGFLTGAAIATFLVTCVVHNFQSRPHSGRRLSP
WEDLSQAPTMDSPLEKNPRPAGRIRHRHGSPHPSRRTVPAVAT
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggctggagggagacctcacctgaagcggagtttctctatcatcccttgcttcgtcttt
gtggagtctgtgttgctaggcatcgtggtccttcttgcgtaccgcctggagttcacggac
accttccctgtgcacacccagggcttcttctgctatgacagcgcttatgccaagccgtat
cccgggcctgaggctgccagccgagcgccccctgccctcatctatgccttggtcactgct
gggcccaccctcacgatcctgctgggggagctggcccgtgccttcttccctgcgccaccc
tcctccagtcctgtcagtggggagagcaccatcgtgtccggggcctgctgccgcttcagt
cccccactgaggaggctggtccgtttcctgggggtgtactcttttggcctcttcaccacg
accatttttgcaaatgcgggacaagtggtgaccggtaaccccacacctcacttcctgtcg
gtgtgtcgccccaactacacggccctgggctgcccaccaccgtctcctgaccggccaggg
cctgaccgcttcgtcacggaccagagcgcctgtgcaggcagtcccagcttggtggccgcc
gcacgccgcgcctttccctgcaaggatgcggccctgtgcgcctacgctgtcacctatact
gcgatgtacgtgaccctagtgttccgcgtgaagggctctcgcctggtgaaaccttccctc
tgcctggccctgctgtgccccgccttcctggtgggcgtggtccgcgtggcggagtatcgc
aaccattggtcggacgtgctggctggctttctgacgggagcagccatcgccacctttttg
gtcacctgtgttgtgcacaatttccagagccgaccccactctggtcgaaggctctccccc
tgggaggacctgagccaggcccccaccatggacagccccctcgaaaagaacccgagacct
gcaggccgcattcgacaccggcacggctcaccccatccaagccgcagaactgtgcccgcc
gtggccacctga

DBGET integrated database retrieval system