KEGG   Mus musculus (mouse): 235086Help
Entry
235086            CDS       T01002                                 

Gene name
Igsf9b, AI414108, AI854107, Gm508, mKIAA1030
Definition
(RefSeq) immunoglobulin superfamily, member 9B
  KO
K22656  immunoglobulin superfamily member 9B
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    235086 (Igsf9b)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  IGSF9
   235086 (Igsf9b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set Ig_2 ig V-set fn3 Ig_6 Ig_4 C2-set_2 Ig_C17orf99 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 235086
NCBI-ProteinID: NP_001313631
MGI: 2685354
Ensembl: ENSMUSG00000034275
Vega: OTTMUSG00000032753
UniProt: A0A1L1SR84
Position
9; 9 A4
AA seq 1441 aa AA seqDB search
MIWYVATLIASVISTRGLVAQGAHGLREEPEFVTARAGEGVVLRCDVIHPVTGQPPPYVV
EWFKFGVPIPIFIKFGYYPPHVDPEYAGRASLHDKASLRLEQVRSEDQGWYECKVLMLDQ
QYDTFHNGSWVHLTINAPPTFTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKEGTLL
GASAKYQVSDGSLTVTSVSREDRGAYTCRAYSIQGEAVHTTHLLVQGPPFIVSPPENITV
NISQDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDGTLIIFRVKPEDAGK
YTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATVVKWN
KDGRPLQVEKNLGWTLMEDGSIRIEEATEEALGTYTCVPYNTLGTMGQSAPARLVLKDPP
YFTVLPGWEYRQEAGRELLIPCAAAGDPFPVITWRKVGKPSRSKHNALPSGSLQFRALSK
EDHGEWECVATNVVTSITASTHLTVIGTSPHAPGSVRVHVSMTTANVSWEPGYDGGYEQT
FSVWYGPLMKRAQFGPHDWLSLSVPPGPSWLLVDSLEPETAYQFSVLAQNRLGTSAFSEV
VTVNTLAFPVTTPEPLVLVTPPRCLTANRTQQGVLLSWLPPANHSFPIDRYIMEFRVGER
WEMLDDAIPGTDGDFFAKDLSQDTWYEFRVLAVMQDLISEPSNIAGVSSTDIFPQPDLTD
DGLARPVLAGIVATICFLAAAILFSTLAACFVNKQRKRKLKRKKDPPLSITHCRKSLESP
LSSGKVSPESIRTLRAPSESSDDQGQPAAKRMLSPTREKELSLYKKTKRAISSRKYSVAK
AEAEAEATTPIELISRGPDGRFVMGPSEMEPSVKGRRIEGFPFAEETDMYPEFRQSDEEN
EDPLVPTSVAALKPQLTPMSSSQDSYLPPPAYSPRFQPRGLEGPSGLGGRLQATGQARPP
APRPFQHGQYYGYLSSSSPGEVEPPPFYMPEVGSPLSSVMSSPPLHTEGPFGHPTIPEEN
GENASNSTLPLTQTPTGGRSPEPWGRPEFPFGGLETPAMMFPHQLHPCDVAESLQPKACL
PRGLPPAPLQVPAAYPGMLSLEAPKGWVGKSPGRGPIPAPPATKWQERPMQPLVSQGQLR
HTSQGMGIPVLPYPEPAEPGGHGGPSTFGLDTRWYEPQPRPRPSPRQARRAEPSLHQVVL
QPSRLSPLTQSPLSSRTGSPELAARARPRPGLLQQAEMSEITLQPPAAVSFSRKSTPSST
GSPSQSSRSGSPSYRPTMGFTTLATGYPSPPPGPAPPAPGDTLDVFGQTPSPRRMGEEPL
RPEPPTTLPTSGILPPAPGNAAVPERLEALRYQRIKKPKKSSKGSSKSKKRSDGSASQAQ
QLPSSQVLWPDEAVCLRKKKRHSRPDPFARLSDLCHRQLPEDQTAILNSVDHDDPGHATL
L
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgatttggtatgtggccactttgatagcaagtgtgatcagcacccgaggtcttgtggct
caaggtgcccacggcctgcgagaggaacccgagtttgtgactgctcgagccggcgaaggt
gtggttctgcgatgcgacgtaatccacccagtgacaggacagcccccaccctatgttgta
gagtggttcaagtttggggtccccatccctatcttcatcaagtttggctactatccccca
catgtggaccctgagtatgcaggccgggccagtcttcatgataaagcatctctgcggctg
gagcaggtgcgctctgaggaccagggttggtacgagtgcaaggtactcatgctggaccag
cagtatgacacattccacaacggcagctgggtccatctcaccattaacgcccctcccacc
tttacagaaacacccccccagtacatcgaggccaaggaaggtggaagtattaccatgacg
tgtactgctttcgggaaccctaagcccatcgtcacctggctcaaggaagggaccctcctc
ggtgctagtgcaaagtatcaggtgagtgacggtagcctaacggtgacgtcagtcagtcgg
gaggacagaggcgcctatacgtgtcgagcatatagcatccagggtgaggctgtgcacaca
acccatctgcttgttcaagggcctcccttcattgtttcccctcctgagaacatcaccgtc
aacatctcccaggatgctctgcttacctgcagggcagaggcgtatcccggcaacctcacc
tacacctggtactggcaggatgagaacgtctacttccagaatgacctgaagctaagggtg
cggatcctgattgatgggacactgatcatcttccgagtgaagccagaggatgctgggaag
tatacctgtgtccctagcaacagcctggggcgctccccctctgcctcagcatacctgact
gtgcagtacccagcccgtgtcctcaacatgccccctgtaatttatgtgcccgtgggaatc
catggctatatccgctgtcctgtggatgcagagccacctgctactgtggtgaagtggaat
aaggatggccggcccctgcaggtagagaagaacttgggttggaccttgatggaggatggc
tctattcgcattgaggaggccacagaggaggctcttggcacttacacctgtgtgccttac
aacaccttggggactatgggccagtctgcccctgcacggcttgtcctgaaggaccccccg
tacttcacggtgctaccaggctgggaatacaggcaggaggctggccgggagctgctcatt
ccctgtgcagctgcaggggaccccttccctgtcatcacctggaggaaggtagggaagccc
agcagaagcaagcacaacgcactgcccagcgggagtctccagtttcgtgccctgagtaag
gaggaccacggggagtgggaatgtgttgccaccaatgtggtcacaagcatcactgccagc
acccacctcactgtcatcggcaccagtccccatgccccaggcagtgtccgggtccatgtc
tccatgacaactgccaacgtgtcctgggagccgggctatgatggaggctacgagcagaca
ttctcagtttggtacggacctctgatgaagcgggctcagtttgggccccacgactggctg
tccttgtcagtgccaccgggccccagctggttgctggtagacagcctggagcctgagacc
gcataccagttcagtgtcctggcccagaacaggctgggaaccagcgccttcagtgaggtg
gtcactgtgaacactttagcattccctgttacaactccagaacccctggtgctggtgacc
ccaccaaggtgcctcacagccaaccggacccagcagggtgtgctcctgtcctggctccca
cctgccaaccacagcttccccatcgaccgctatatcatggagttccgagttggggagcgc
tgggagatgctggatgacgccattccaggcactgacggagatttttttgccaaggatctg
tcacaggatacctggtatgaattccgggttttggctgtcatgcaggatctgatcagcgag
cccagcaacatcgccggtgtctccagcacagacatcttcccgcagccagacctgaccgat
gatgggctggcccggccagtgttggctgggatagtggccaccatctgcttcctggcagct
gccatcctcttcagcactctggctgcctgctttgtcaacaagcagcgcaagcgcaaactc
aagcggaagaaagatcctccgctctccatcactcactgtaggaagagtcttgagtctccc
ttgtcctctggcaaggtgagtcccgagagcatccgcacactccgagccccgtctgaatcc
tctgacgaccagggccagcctgcggccaagaggatgctgagccctacaagggaaaaagag
ctgtccctatacaaaaaaaccaagagggctatcagcagcaggaagtatagtgtggccaag
gctgaggccgaagctgaggctaccacacccattgaactgatcagtagaggcccggatggc
cgctttgtcatgggcccatcggagatggagccctctgtgaagggtcggcgaatcgagggc
ttccccttcgctgaggagacggacatgtaccctgagttccggcagtcagatgaggagaat
gaagacccactggtgcccacgtctgtggctgctctgaagcctcagctgaccccaatgtct
tccagccaggactcttacctgccaccaccagcatacagtcctcggttccagcctcgtggg
ctcgagggcccgagcggactgggaggacgactccaggctactggccaagcgaggcctcct
gcccctcggcccttccagcacggccagtattatgggtacctcagcagcagcagccctggg
gaagtggagcctccacccttctatatgccagaagtgggcagccccttgagctctgtcatg
tcgtccccacccctgcacaccgaggggccttttggccaccccaccatccctgaggaaaac
ggagagaatgcttctaacagcactttacccttgactcagacacctacaggagggcgctcc
cctgagccctggggccggccagaatttccctttgggggactggagaccccagctatgatg
ttcccccaccagctgcacccctgtgatgtggccgagagtttgcagcccaaggcctgcctg
ccccgaggactgcccccagcccctctccaggtgcctgctgcctatccgggcatgctatct
ctggaggcaccaaagggctgggtaggcaagtcacctggcaggggtcccatcccggcgccc
cctgccaccaagtggcaggaaagacctatgcaacctctggtcagccaagggcagctaaga
cataccagccaaggtatggggataccggtgttgccttacccggagccagccgagcccggg
gggcatggtggccccagcacatttggcctggatacccggtggtatgagccccagcctcgg
ccccggcccagcccccggcaggcccggcgtgccgagcccagtttacatcaagtggtgcta
cagccctctcggctctcacctctgacccaaagcccccttagttcccgcactggctcccct
gagctcgctgctcgtgcccgacctcgaccaggcctcctgcagcaggcagagatgtcagag
atcaccctgcagccgccagctgcggtcagcttctctcgaaagtcaacaccatcatccacg
ggatctccttcgcagagcagccgcagtgggagccccagctacaggcccacaatgggcttc
actactctggccacgggctacccttctcctccacctggccctgcccctccggcaccaggg
gacaccttggatgtgtttggacagacgccttcccctcggaggatgggggaggagccactc
cggccagagcccccaacaaccttacctacttcaggaatacttccacctgcacccgggaac
gctgctgtgcctgagaggctggaggctctgagataccaacggataaagaagcccaaaaag
tcatccaagggctcttcgaagtcaaagaaacgatccgacggttctgcctcccaggctcag
cagcttcccagctctcaggttctgtggcccgacgaagctgtctgcctccgcaagaagaag
agacactctcgtcctgatccctttgcccggctctcagacttgtgccaccgtcagcttccg
gaagaccagacagcaatcctcaacagcgtggatcatgatgacccaggccacgctactctg
ctatga

DBGET integrated database retrieval system