KEGG   Mus musculus (house mouse): 235132
Entry
235132            CDS       T01002                                 
Symbol
Zbtb44, 6030404E16Rik, Btbd15, E230011F09
Name
(RefSeq) zinc finger and BTB domain containing 44
  KO
K10515  zinc finger and BTB domain-containing protein 44
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    235132 (Zbtb44)
   04121 Ubiquitin system [BR:mmu04121]
    235132 (Zbtb44)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    235132 (Zbtb44)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     235132 (Zbtb44)
SSDB
Motif
Pfam: BTB zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_11 zf-met zf-C2HE zf-H2C2_5 Glyco_tran_10_N zf-C2H2_9
Other DBs
NCBI-GeneID: 235132
NCBI-ProteinID: NP_001108602
MGI: 1925123
Ensembl: ENSMUSG00000047412
UniProt: Q8R0A2
Position
9:30941016..30987181
AA seq 453 aa
MGVKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDKIFRAHKVVLAACSDFFRTKL
VGQTEDENKNVLDLHHVTVTGFIPLLEYAYTATLSINTENIIDVLAAASYMQMFSVASTC
SEFMKSSILWNTPNSQPEKSLDAGQENSSNCNFTSRDGSISPVSSECSAVERTIPVCRES
RRKRKSYIVMSPESPVKCSTQTSSPQVLNSSASYAENRSQPVDSSLAFPWTFPFGIDRRI
QPEKAKQAENTRTLELPGPSEAGRRVADYVTCESTKPTLPLGTEEDVRVKVERLSDEEVH
EEVSQPVSASQSSLSDQQTVPGSEPVQEDLLISPQSSSIGSVDEGVTEGLPTLQSTSSTN
AHADDDDRLENVQYPYQLYIAPSTSSTERPSPNGPDRPFQCPTCGVRFTRIQNLKQHMLI
HSGIKPFQCDCCGKKFTRAYSLKMHRLKHEVIS
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgggtgtgaaaacatttactcacagctcctcttcccacagccaggaaatgctggggaaa
ctaaatatgctccgaaatgatggacatttttgtgatatcactattcgtgtccaggacaaa
atcttccgggctcacaaggtagtactagcagcttgcagtgatttctttcgaaccaaactt
gttggccaaacagaagatgagaacaaaaatgtgttggatctgcatcatgttacagtgact
ggctttatacctcttttagaatacgcttacacagccactctgtcaattaacacggaaaat
attattgatgttctagcggcagccagctatatgcaaatgtttagtgttgctagtacatgc
tcagagttcatgaagtcaagtattttgtggaatacacctaatagccaaccagaaaagagt
ctagatgctggacaagaaaatagctccaactgcaattttacttctcgagatggaagcatt
tctccagtgtcttcagagtgcagtgctgtggagaggaccattcctgtctgccgagagtcc
cggaggaagcgcaaaagctacattgttatgtctcccgagagtcccgtgaaatgtagcacc
caaacaagttccccccaggtactgaattcttcagcttcctatgcagaaaatagaagtcag
ccagttgactcttctttagcttttccttggactttcccttttggaatagatcgaaggatt
cagcctgagaaagcaaagcaggcagaaaatacccggactttagaattgcctggcccatcc
gaggcaggtagaagagtggctgactatgtgacttgtgagagcacaaaacccaccttgcct
ctaggtacagaagaagatgtccgggtcaaagtagaaagattaagtgatgaggaggtccat
gaggaagtgtcccagcctgttagtgcatctcagagctcactgagtgatcagcagacagtg
cccggaagtgaaccagttcaagaggaccttctgatcagtccacagtcttcctctataggc
tcagtagatgaaggagtcactgaaggattgcctacacttcagagcacctctagcaccaat
gctcatgcagatgacgatgacagattggaaaatgttcagtatccctatcaactctacatt
gctccttctaccagcagtacagagcggccaagtccaaatggtccagacagaccgtttcag
tgtccaacctgtggggtccgcttcacccgtattcagaatctaaaacagcacatgcttatc
cactcaggaattaaaccatttcagtgtgactgctgtggaaaaaagtttaccagggcttac
tcgctaaagatgcatcgcctaaagcacgaagtgatttcttag

DBGET integrated database retrieval system