KEGG   Mus musculus (mouse): 235134Help
Entry
235134            CDS       T01002                                 

Gene name
Nfrkb, A530090G11Rik
Definition
(RefSeq) nuclear factor related to kappa B binding protein
  KO
K11671  nuclear factor related to kappa-B-binding protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    235134 (Nfrkb)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   INO80 complex
    235134 (Nfrkb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NFRKB_winged Apt1
Motif
Other DBs
NCBI-GeneID: 235134
NCBI-ProteinID: NP_766354
MGI: 2442410
Ensembl: ENSMUSG00000042185
Vega: OTTMUSG00000034118
UniProt: Q6PIJ4
Position
9; 9 A4
AA seq 1296 aa AA seqDB search
MDSLDHMLTDPLELGPCGDGHSTGIMEDCLLGGTRVSLPEDLLEDPEIFFDVVSLSTWQE
VLSDSQREHLQQFLPRFPADSVEQQRELILALFSGENFRFGNPLHIAQKLFRDGHFNPEV
VKYRQLCFKSQYKRYLNSQQQYFHRLLKQILASRSDLLEMARRSGPALPFPHKHHSPSRS
PEEREWRTQQRYLKVLREVKEECGDTALSSDEEDLSSWLPSSPARSPSPAVPLRVVPTLS
TTDMKTADKIELGDSDLKLMLKKHHEKRKHQPDHPDLLTGDLTLSDIMTRVNAGRKGSLA
ALYDLAVLKKKVKEKEEKKKKKIKLIKSEAEDLAEPLSSTEGVPTLSQAPSPLAISSIKE
EPLEDIKPCLGINEISSSFFSLLLEILLLESQASLPMLEDRVLDWQSSPASSLNSWFSAA
PNWAELVLPALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFHLWLE
TKDQAFCKENEDSSDAMTPVPRVRTDYVVRPSTGEEKRVFQEQERYRYSQPHKAFTFRMH
GFESVVGPVKGVFDKETSLNKAREHSLLRSDRPAYVTILSLVRDAAARLPNGEGTRAEIC
ELLKDSQFLAPDVTSTQVNTVVSGALDRLHYEKDPCVKYDIGRKLWIYLHRDRSEEEFER
IHQAQAAAAKARKALQQKPKPPSKVKSSNKEGSTKGLSGPSEQSQMSLSDSSMPPTPVTP
VTPTTPALPTPISPPPVSAVNRSGSSTVSEPAQSSSGVLLVSSPTMPQLGTMLSPASIQT
PPSSQATARVVSHSSSAGLPQVRVVAQPSLPAVSQQSVGPAQPLPQMPAGPQIRVPVTAT
QTKVVPQAVMATVPVKGQTAAASVQRPGPGQTGLTVTNLPAAVSPVSKTAMSSPGNSAPS
ASTTAVIQNVTGQNIIKQVSITGQLGVKPQTGSSIPLTATNFRIQGKDVLRLPPSSITTD
AKGQTVLRITPDMMATLAKSQVTTVKLTQDLFGAGSGTAGKGISATLHVTSNPVHAADSP
AKAPSASVPSSAPAGTTVVKVTPDLKPTETANSAFRLMPALGVSVADQKGKNTVASSEAK
PAATIRIVQGLGVMPPKAGQTITVAAHAKQGASVAGGSGTVHSSTVSLPSINAAVSKTVA
VASGATSTPISIGTGAPTVRQVPVNTTVVSTSQSGKLPTRITVPLSVISQPMKGKSVVTA
PIIKGNLGANLSGLGRNIILTTMPAGTKLIAGNKPVSFLTAQQLQQLQQQGQATQVRIQT
VPASHLQQGTASGSSKAVSTVVVTTAPSPKQAPEQQ
NT seq 3891 nt NT seq  +upstreamnt  +downstreamnt
atggattccttggaccacatgctgacagatccccttgaacttggtccttgtggagatggt
cacagtacaggaatcatggaggactgccttctgggtggtaccagggttagtctgcccgaa
gaccttctggaggatcccgagatattctttgatgtcgtcagcctgtccacatggcaggaa
gtattaagtgactctcagcgtgagcacctccagcagttcctgcctcggtttcctgcggac
agtgtggagcagcagagggagctcatccttgccctattcagtggggagaacttccgcttc
ggaaacccgctgcacatcgcccagaagctcttccgagatggacactttaaccctgaggtg
gtcaagtatcgtcagctctgcttcaagtcacagtacaagcggtatctcaactcccaacaa
cagtatttccaccggctgctgaaacagattcttgcttccaggagtgatctcttggagatg
gctcgtaggagtggccctgctcttccctttccacacaagcaccattcaccgtcccgaagc
cccgaggagcgggagtggcggacccagcagcgttacttgaaagtcttgagggaagtgaag
gaggaatgtggggacactgctctgtcctctgatgaggaggatctcagctcatggcttcca
agctctccagcacgttctcctagtcctgcggtgcccctgagggtggtgcccacgctttcc
accacggatatgaaaactgcagataaaatagaactgggggacagtgacctgaagttaatg
ttaaagaagcaccatgagaagcggaaacatcaaccagatcacccagaccttttgacaggg
gacctgaccctcagtgacatcatgactcgagtaaatgccggcaggaagggctccctagca
gccttgtatgatttggctgttcttaaaaaaaaggtgaaggaaaaggaggagaagaaaaag
aagaaaataaagttgattaagtcggaagcagaggatctggctgagcccctaagcagtact
gaaggggtcccaactctctcacaggccccctctcccctggcaatatcgtctatcaaggag
gaacccctggaagacatcaagccttgccttggaatcaatgaaatatcttccagttttttc
tctcttctgttagagatcttgctgctggaaagtcaggctagccttcctatgctggaggat
cgagttttggactggcagtcttctccagccagctccctcaacagctggttctctgctgcc
cccaactgggctgagttggtgttgcctgctctgcagtatcttgctggagaaagccgagcg
gttccttctagtttctctccatttgttgaattcaaagagaaaacccagcagtggaaattg
cttggtcaatctcaagataatgaaaaggaattagctgctctcttccacctgtggctggaa
accaaagaccaggccttctgtaaggaaaatgaagacagctcagatgccatgacacctgtc
cctcgagtaagaactgactatgtggttcggcctagcacaggagaggagaaacgggttttt
caagaacaggagcgttacaggtatagccaaccccataaggcattcacctttcgcatgcat
ggctttgagtctgtggtggggccagtgaagggcgtgtttgacaaggagacctccctcaac
aaggctcgtgagcattcactgctgcgctctgaccggcctgcctatgtcaccattctgtct
cttgttcgggatgctgcagctcggctgcctaatggagaaggcactcgggcagagatctgt
gaactgctcaaggactctcagtttctggctccagatgtcaccagcactcaggtgaacaca
gtggtgagtggcgcactggatcgattgcattatgagaaagacccttgtgtgaaatatgac
atcggtcggaagctgtggatctacctgcatcgtgaccggagtgaggaagagtttgaacgg
attcatcaagctcaagcagcggcagctaaagccagaaaagctcttcaacaaaaacccaag
ccgccatccaaggtgaagtccagtaataaggagggctccacgaagggccttagcggtcct
tccgagcagagccagatgagcctcagtgactctagcatgccgcccaccccagttacgcct
gtaacacccaccacgccagcattgcccacccccatctctcctccacccgtgtcagcggtg
aacagaagtggctctagcacggtctctgagccagcccagtctagttcaggtgtgcttctg
gtgtcctcaccgacaatgccacagctagggacgatgctttccccagcttccatccagact
ccacccagttctcaggccactgctcgggttgtcagccattccagctcagcaggactaccc
caggttcgggtggtagcccagcccagccttcctgctgtttcccagcagtcagtagggcca
gcacagccactaccccagatgccagcaggaccacagattcgtgtgccagtcactgctact
caaaccaaagtagtaccccaggcagttatggcaacagttccagtcaaggggcaaactgca
gcagcctctgtgcaacggcctggacctgggcagacagggctcacagtgacgaatcttccg
gctgcagtcagccccgtgagcaagacagccatgagttctcctgggaactctgctccaagt
gcctccaccacagccgttattcagaacgtcacaggacagaacatcatcaagcaggtgtcg
atcactggacagcttggtgtgaagccccagacaggcagcagcattccactcacagccaca
aacttccgtatccagggtaaggatgtactgcgcctgccgccttcttccatcaccacagat
gccaagggccagacggttttgagaatcactccagacatgatggccacattggccaagtct
caggttaccacagtcaaactgactcaggacctctttggagcaggaagtggcactgcaggc
aaaggcatctctgctaccttgcatgttacttccaaccctgtccacgcggctgacagccct
gccaaggccccttcagccagtgtcccttcatcagctccagcaggtactactgtggtcaaa
gtaactcctgatctcaagccgacagaaactgcaaattcagcttttcgcttgatgccagct
cttggtgtaagtgtggcagatcagaagggaaagaacacagtggcctcttcagaagcaaaa
cctgccgccacaatccgcatcgtgcaggggctgggagtgatgccccctaaagcaggccag
accattactgttgcagcacatgcaaagcaaggagcctctgttgctggagggtctggaact
gtccattcttcaacggtgtccttacccagtataaatgccgctgtgtcaaagactgtggct
gtggcctctggggcaacaagcacccccatcagcatcgggactggagcccccaccgtgcga
caggttcctgttaacactacagttgtgtccacatcccagtctgggaaactgcctaccaga
atcacagttcctctttctgtgattagccagccaatgaagggcaagagcgtggtcacagcc
cccatcatcaaaggcaaccttggagccaatctcagtgggctgggtcgcaacatcatcctc
acgaccatgccagcaggtaccaaactcattgctggcaataagccagtgagtttcctcact
gctcagcagttgcagcagcttcagcaacaaggtcaggctacacaggtgcgcatccagacc
gtcccggcatcccatctgcaacagggcacggcttctggctcctccaaagcagtgtccact
gttgttgtgaccacagctccatctcctaaacaagcacctgagcagcagtga

DBGET integrated database retrieval system