KEGG   Mus musculus (mouse): 235256Help
Entry
235256            CDS       T01002                                 

Gene name
Olfr149, M31, MOR224-8
Definition
(RefSeq) olfactory receptor 149
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    235256 (Olfr149)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    235256 (Olfr149)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    235256 (Olfr149)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF1980
Motif
Other DBs
NCBI-GeneID: 235256
NCBI-ProteinID: NP_997021
MGI: 2660716
Ensembl: ENSMUSG00000062121
Vega: OTTMUSG00000062387
UniProt: Q60888
Position
9; 9 A5.1
AA seq 311 aa AA seqDB search
MKNLSVVTQFILLGIPHTEGVETMLFVLFFSFYIFTLVGNLLILLAIVSSSRLHTPMYFF
LCQLSVCDIFFPSVSSPKMLFYLSGNTPAISYAGCVSQLFFYHFLGGTECFLYTVMAYDR
FVAICYPLRYSVIMSHRICAFLAMGTAVFGCIHSTFLTTLTFQLPYCGPKDVNYYFCDIP
VVMKLACADTSTLEMVGFISVGLMPLSCFFFILTSYSCIVRSILQIRSTEGRHRAFSTCS
AHFTAILLFYMPVIFIYLRPTPSPWLDATVQILNNLVTPMLNPLIYSLRNKEVKSSLWTV
LHLLCFLPKHL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacctttcagtagtgactcagtttatcctactgggcatcccacacacagagggt
gtggagaccatgctctttgtcctgtttttttctttctacatcttcactctcgtggggaac
ttgctcatactccttgcaattgtctcctccagtcggcttcacactcccatgtacttcttc
ctgtgccagctgtcagtgtgtgacatatttttcccgtctgtgagttctcccaagatgctg
ttctacctctcaggaaatactccagccatctcctatgcaggttgtgtgtcccagctcttc
ttctatcatttcctgggtggtactgagtgtttcctgtacacagtgatggcttatgaccgt
tttgttgccatatgctaccctctacgctactcagtcataatgagtcatagaatttgtgcc
ttcctggccatggggacagcagttttcggctgtattcattccacctttctaactactctc
accttccagttgccctactgtggccccaaagatgtgaactattacttctgtgatattcct
gtggtgatgaagctggcttgtgcagacacatcgaccctggagatggtagggttcatcagt
gtgggtctcatgcccctcagttgcttcttcttcatcctcacctcctacagctgtatagtt
cggtccatcctacagatccgctccactgagggtcgacatagagccttctccacctgcagt
gcccattttactgccattttgctcttttacatgccagtgattttcatttatctaaggcca
acaccaagtccttggttggatgcaactgttcagattctgaacaatctggtcacccctatg
ctaaatccgttaatttacagtcttaggaataaggaggtgaaatcatcactgtggactgtc
ctacatctgctgtgcttccttcccaagcatttgtaa

DBGET integrated database retrieval system