KEGG   Mus musculus (mouse): 235339
Entry
235339            CDS       T01002                                 

Gene name
Dlat, 6332404G05Rik, DLTA, PDC-E, PDC-E2
Definition
(RefSeq) dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00020  Citrate cycle (TCA cycle)
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
Module
mmu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    235339 (Dlat)
   00020 Citrate cycle (TCA cycle)
    235339 (Dlat)
   00620 Pyruvate metabolism
    235339 (Dlat)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     235339 (Dlat)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Other DBs
NCBI-GeneID: 235339
NCBI-ProteinID: NP_663589
MGI: 2385311
Ensembl: ENSMUSG00000000168
Vega: OTTMUSG00000016493
UniProt: Q8BMF4
Position
9; 9 A5.3
AA seq 642 aa
MWRVCARRARSAVPRDGFRARWAALKEGPGAPCGSPRIGPAAVRCGSGIPRYGVRSLCGW
SSGSGTVPRNRLLRQLLGSPSRRSYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGEKISE
GDLIAEVETDKATVGFESLEECYMAKILVPEGTRDVPVGSIICITVEKPQDIEAFKNYTL
DLAAAAAPQAAPAAAPAPAAAPAAPSASAPGSSYPTHMQIVLPALSPTMTMGTVQRWEKK
VGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGAPLCIIVEKQEDIA
AFADYRPTEVTSLKPQAAPPAPPPVAAVPPTPQPVAPTPSAAPAGPKGRVFVSPLAKKLA
AEKGIDLTQVKGTGPEGRIIKKDIDSFVPSKAAPAAAAAMAPPGPRVAPAPAGVFTDIPI
SNIRRVIAQRLMQSKQTIPHYYLSVDVNMGEVLLVRKELNKMLEGKGKISVNDFIIKASA
LACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLA
SKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLIPADNEKG
FDVASVMSVTLSCDHRVVDGAVGAQWLAEFKKYLEKPITMLL
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgtggcgcgtctgtgcgcggagggcgcggagtgctgtgcccagggatgggttcagggct
cggtgggcggccttgaaggaaggccccggggccccatgcgggagcccgcggattggcccc
gctgcggtccgttgcggtagtgggatcccccgctatggggtccgctccttgtgcggctgg
agctccggctccggcactgtcccgcgtaaccgcttgctgcgacaactcctggggtcgccc
agccgccgctcttacagcctccctccgcatcagaaggttccattaccttccctttcccct
acaatgcaggcaggcaccatagcccgctgggaaaaaaaagaaggggaaaaaatcagtgag
ggtgatctaattgcagaggttgaaactgataaagccactgttgggtttgagagcctggag
gagtgctatatggccaagatccttgttcctgaagggaccagagatgttccagttgggtcc
atcatctgtatcacagttgaaaagcctcaggatattgaggcctttaaaaattatacattg
gatttggcggcggcagctgccccacaggcagccccagctgcagccccagctccagctgct
gccccagcggcaccttctgcaagcgctcccggtagctcctatcctactcatatgcagatt
gttcttcctgccctctccccaaccatgaccatgggcacggtccagaggtgggaaaagaaa
gtgggcgagaagctgagtgaaggagacttgctggcagagatagagaccgacaaggccacc
ataggctttgaagtacaagaagaaggttatctggcaaaaatcctggtccctgaaggcaca
agggatgttcctctgggagctccactatgtatcatagtagaaaaacaggaagatatagca
gcatttgcagactacaggccaacagaagtgaccagcttaaagccacaggcagcaccacct
gccccacccccggtggcagctgttcctcccactccccagcctgtagcacctaccccctca
gctgctcctgctggaccaaagggaagggtgttcgttagtcctcttgcgaagaagttggca
gcagagaaagggattgacctcacccaagttaaagggacgggaccagaaggcagaatcatc
aagaaggacattgactcttttgtgccttctaaggctgctcctgctgcagcagctgccatg
gctcccccgggtccaagagtggcaccagctcctgcaggtgtcttcacagacatccccatc
agcaacattcgtcgagtgattgcgcagaggctcatgcagtcgaagcagactatacctcat
tattacctttctgtcgatgtaaatatgggagaggtgctgttggtacggaaggaacttaat
aagatgcttgaagggaaagggaaaatctccgtcaacgacttcattataaaggcttcagct
ttggcctgtctgaaagttcccgaagcaaactcgtcttggatggacacagttataaggcaa
aatcatgtggttgacgtcagtgttgctgtcagtacccctgcaggacttatcacccctatt
gtgtttaatgcacacataaaaggactggaaaccattgctagtgatgttgtttctttagcc
tccaaagcgagagagggtaaacttcagcctcatgagttccagggtggaacatttacaatc
tccaacttagggatgtttggaattaagaatttctctgcaattattaatccacctcaggca
tgtattctggcaatcggtgcttcagaggataaactgatcccagcagataatgagaaaggc
tttgatgtggctagtgtgatgtccgttacactcagctgtgatcatcgagttgtggatgga
gcagttggagcccagtggcttgctgaattcaaaaagtaccttgaaaagcctataactatg
ttgttataa

DBGET integrated database retrieval system