KEGG   Mus musculus (mouse): 235402Help
Entry
235402            CDS       T01002                                 

Gene name
Lingo1, 4930471K13Rik, AV148400, LERN1, LINGO-1, Lrrn6a, UNQ201
Definition
(RefSeq) leucine rich repeat and Ig domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_5 LRR_4 I-set Ig_3 Ig_2 LRR_9 ig LRRNT V-set
Motif
Other DBs
NCBI-GeneID: 235402
NCBI-ProteinID: NP_851419
MGI: 1915522
Ensembl: ENSMUSG00000049556
Vega: OTTMUSG00000016697
UniProt: Q9D1T0
Position
9; 9 B
AA seq 614 aa AA seqDB search
MLAGGMRSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRKRFVAVP
EGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGL
RSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRA
FSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYRLKVLEI
SHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPIGTIEGSM
LHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTLEESAFHSVGNLETLIL
DSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFTCRRAHI
RDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDGTLEVRY
AQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRA
TVPFPFDIKTLIIATTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPRKSDAGI
SSADAPRKFNMKMI
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgctggcagggggtatgagaagcatgcccagccccctcctggcctgctggcagcccatc
ctcctgctggtactgggctcagtgctgtcaggctctgctacaggctgcccgccccgctgc
gagtgctcagcgcaggaccgagccgtgctctgccaccgcaaacgctttgtggcggtgccc
gagggcatccccaccgagactcgcctgctggacctgggcaaaaaccgcatcaagacactc
aaccaggacgagtttgccagcttcccacacctggaggagctagaactcaatgaaaacatc
gtgagcgccgtggagccaggcgccttcaacaacctcttcaacctgaggactctggggctg
cgcagcaaccgcctgaagcttatcccgctgggcgtcttcaccggcctcagcaacttgacc
aagctggacatcagtgagaacaagatcgtcatcctgctagactacatgttccaagaccta
tacaacctcaagtcgctggaggtcggcgacaacgacctcgtctacatctcccatcgagcc
ttcagcggcctcaacagcctggaacagctgacgctggagaaatgcaatctgacctccatc
cccacggaggcgctctcccacctgcacggcctcatcgtcctgcggctacgacatctcaac
atcaatgccatcagggactactccttcaagaggctgtaccgacttaaggtcttagagatc
tcccactggccctacctggacaccatgacccccaactgcctctacggcctcaacctgaca
tccctatccatcacgcactgcaacctgacagccgtgccctatctggcagtgcgtcacctg
gtctatctccgtttcctcaacctttcctacaacccaatcggtacaatcgagggctccatg
ctgcatgagctgctgcggttgcaggagatccagctggtgggcgggcagctggccgtggtg
gagccctatgcctttcgtgggctcaactacctgcgtgtgctcaatgtctctggcaaccag
ctgaccaccctggaggagtcagccttccattcggtgggcaacctggagacgctcatcctg
gactccaacccactggcctgtgactgccggctgctgtgggtgttccggcgccgctggcgg
ctcaacttcaacaggcagcagcccacctgcgccacacctgagttcgtccagggcaaagag
ttcaaggactttccggatgtactcctacccaactacttcacctgccgccgggcccacatc
cgggaccgcaaggcacagcaggtgtttgtagatgagggccacacggtgcagtttgtatgc
cgggcagatggcgaccctccaccagctatcctttggctctcaccccgcaagcacttggtc
tcggccaagagcaatgggcggctcacagtcttccctgatggcacgctggaggtgcgctac
gcccaggtacaggacaacggcacgtacctgtgcatcgcagccaatgctggcggcaacgac
tccatgcccgcccacttgcatgtgcgcagctactcgcctgactggccccatcaacccaac
aagaccttcgccttcatctccaaccagccaggcgagggagaggccaacagcacccgcgcc
actgtgcctttccccttcgacatcaagacgctcattatcgccaccaccatgggcttcatc
tccttcctgggcgttgtcctattctgcctggtgctgctgtttctatggagccggggcaaa
ggcaacacaaagcacaacatcgaaattgagtatgtgccccggaaatcggacgcaggcatc
agctcagctgatgcaccccgcaagttcaacatgaagatgatatga

DBGET integrated database retrieval system