KEGG   Mus musculus (mouse): 235416
Entry
235416            CDS       T01002                                 

Gene name
Lman1l, BC020188, slamp
Definition
(RefSeq) lectin, mannose-binding 1 like
  KO
K10081  lectin, mannose-binding 1-like
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    235416 (Lman1l)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    235416 (Lman1l)
Lectins [BR:mmu04091]
 L-type lectins
  235416 (Lman1l)
SSDB
Motif
Pfam: Lectin_leg-like
Other DBs
NCBI-GeneID: 235416
NCBI-ProteinID: NP_954692
MGI: 2667537
Ensembl: ENSMUSG00000056271
Vega: OTTMUSG00000029965
UniProt: Q8VCD3
Position
9; 9 B
AA seq 505 aa
MLEIRGLSPSLCLLSLLLVLHGAERSQPPPRRRFEYKLSFKGPRLAVPGAGIPFWSHHGD
AILGLEEVRLVPSMKNRSGAVWSNISVSFPSWEVEMQMRVTGPGRRGAQGVAMWYTKDRA
QVGSVVEELASWDGIGIYFDSSTSDVQDSPVIRVLASDGHDLQEQSGDGNVRELGSCHRD
FRNRPFPFRARVTYWRQRLRVSLSGGLTPKDPEEVCVDVEPLFLAPGGFFGVSAATGTLA
ADDHDVLSFLTFSLREPGPEETPQPFMEKDQLLLARKLEELKARLALGTREASIPPLNPK
AQEEGERFFNLEDTLGRQSQILQALQALSRQMAQAEKHWKQQLGSTVQVRPEGGWNTAKV
STLLYGQRTLIQALQEMREAAARMASGAHVFYLPVGTKHHFFELDHILSLLQKDLRGLVK
KTAKAPRPSGWLLGSSTCLHTSIFLFFLLLQTVGFFCYVNFSRQELDKRLQEYLSTGSLS
LEPALPITRTIGVLRRQPISPSMQA
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgctggagatcagaggcctctcaccttccctctgcctcctttccctgttgctggttctg
cacggtgctgaaaggagccagccccctcctcgacgcaggtttgagtacaagctcagcttc
aagggaccaagactggcagttcctggggctgggatacccttctggagccaccatggagac
gccatcctaggcttagaggaagtgcggctggttccatccatgaagaaccggagcggtgcc
gtgtggagcaacatctctgtctccttcccttcctgggaggtagagatgcagatgagagtg
actggaccaggacgccggggagcccagggtgtggccatgtggtacaccaaggacagggct
caagtcggctctgttgtagaggagctagcctcatgggatggcatcgggatctactttgat
tcctccaccagtgatgtccaggacagccctgtcatccgagtgctggccagtgatgggcat
gacctccaggagcagtctggggatggaaatgtccgggagcttggctcctgtcacagggac
ttcaggaaccggccattccccttccgagctcgggtcacctactggaggcagaggctgcgt
gtgtctttgagtggaggccttactcctaaggaccctgaagaggtctgtgttgatgtggag
cccctgtttttagcccctggaggcttctttggggtctcagcagccactggcaccttagca
gcagatgaccatgacgtcctgtccttcctgaccttcagtctgagggaaccaggtccagag
gaaaccccccagccattcatggagaaggatcagttgctcctggccaggaagctggaagaa
ctgaaggcaaggctggccctgggcaccagagaggctagcataccaccactgaatcccaaa
gcccaggaagaaggtgaaaggttctttaacctggaggatacgctgggcagacaaagccag
atcctacaggccctccaggctctctccaggcagatggcccaggctgagaagcactggaaa
cagcagctggggtctacagtccaagtccggcctgagggaggctggaacactgccaaggtc
agcaccctgctctatggacagcggaccctgatccaggccctgcaagagatgagggaagca
gctgcccggatggcttcaggagcacacgtcttctacctgcctgtgggcactaagcatcac
ttttttgaactggaccatatcctcagcctcctgcagaaggacctccggggtctggtgaag
aagacagccaaggcccctcgcccatctggctggcttctaggatcctccacatgtctgcac
accagcatcttcctgttcttcctcctactccagactgtaggcttcttctgctacgtgaac
ttcagcaggcaggagctggacaagaggcttcaggagtacctgtccacaggaagcctttct
ctagagcctgcattacccatcaccaggacgataggggttctgaggagacagcccatctcc
cccagcatgcaagcctga

DBGET integrated database retrieval system