KEGG   Mus musculus (house mouse): 235504
Entry
235504            CDS       T01002                                 
Symbol
Slc17a5, 4631416G20Rik, 4732491M05, AST, ISSD, NSD, SD, SIALIN, SIASD, SLD
Name
(RefSeq) solute carrier family 17 (anion/sugar transporter), member 5
  KO
K12301  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 5
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    235504 (Slc17a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    235504 (Slc17a5)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   235504 (Slc17a5)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    235504 (Slc17a5)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 235504
NCBI-ProteinID: NP_766361
MGI: 1924105
Ensembl: ENSMUSG00000049624
UniProt: Q8BN82
Position
9:complement(78443769..78495346)
AA seq 495 aa
MRPLLRGPAGNDDEESSDSTPLLPGARQTEAAPVCCSARYNLAILAFCGFFVLYALRVNL
SVALVDMVDSNTTLTDNRTSKECAEHSAPIKVHHNHTGKKYKWDAETQGWILGSFFYGYI
VTQIPGGYIASRVGGKLLLGLGILGTSVFTLFTPLAADLGVVTLVVLRALEGLGEGVTFP
AMHAMWSSWAPPLERSKLLTISYAGAQLGTVISLPLSGIICYYMNWTYVFYLFGIVGIVW
FILWMWIVSDTPETHKTISHYEKEYIVSSLKNQLSSQKVVPWGSILKSLPLWAIVVAHFS
YNWSFYTLLTLLPTYMKEILRFNVQENGFLSALPYFGCWLCMILCGQAADYLRVKWNFST
ISVRRIFSLVGMVGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFASSGFSINHLDIAPS
YAGILLGITNTFATIPGMTGPIIAKSLTPDNTIREWQTVFCIAAAINVFGAIFFTLFAKG
EVQSWALSDHHGHRN
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgaggcccctgcttcggggtccggcgggaaacgacgatgaggagagctcggacagcacc
ccgctcctgccgggcgcccggcagaccgaagcggctccagtgtgctgctctgctcggtac
aacttagcgattttggcgttctgtggtttcttcgttctctatgccttacgggtgaacctg
agtgttgcgttagtggacatggtagattcaaatacaactctgactgataatagaacgtct
aaggagtgtgcggaacattctgcccccataaaagttcaccacaatcacacaggtaaaaag
tacaagtgggatgcagaaactcaagggtggattctcggctcttttttttacggctacatc
gtcacccagattcccggtgggtacattgccagcagggtcggagggaagctgctgctgggc
ctgggcatcttaggcacctccgtcttcaccctgttcacaccgctggccgcagacttaggc
gtggtgactctcgttgtgcttagagcgctggaaggactgggagagggtgttacgtttcca
gctatgcacgccatgtggtcttcctgggctccccctctggaaagaagcaagcttcttacc
atttcctatgcgggagcacagcttgggacagtgatctcacttcctctttccggaataata
tgctactatatgaactggacttacgtcttctatctttttggtatagttggaattgtctgg
tttattttatggatgtggatagtcagtgatacaccagaaactcacaagacaatctcccat
tatgaaaaagaatacattgtttcatcattaaaaaatcagctttcttcgcagaaggtggtg
ccgtgggggtccatcttgaagtcactgccactttgggcaattgtggtagcacatttctcc
tacaactggtctttttacaccttattgacgctactgccaacttatatgaaggaaatccta
aggttcaatgttcaagagaacgggtttttatctgcattgccttattttggctgttggtta
tgcatgatcctctgtggtcaagccgctgactatttaagggtcaagtggaacttttcaact
ataagcgttcggagaatttttagcctcgtaggaatggttggccctgcggttttcctagtc
gcggctggatttataggctgtgactattccttggccgttgcgttcctaaccatatccacg
acgctgggaggcttcgcctcttctggatttagcatcaaccatctggatatcgctccttcg
tatgctggcatcctcttgggcatcacaaacacgtttgccactattcccgggatgacggga
cccatcattgctaaaagtctgacccctgataacactattagggaatggcagactgtcttc
tgtatcgctgctgctattaacgtgtttggggccattttcttcacgctgtttgccaaaggg
gaagtgcagagctgggctctcagtgaccaccacggacacagaaactga

DBGET integrated database retrieval system