KEGG   Mus musculus (mouse): 235527Help
Entry
235527            CDS       T01002                                 

Gene name
Plscr4, AV245873
Definition
(RefSeq) phospholipid scramblase 4
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Scramblase
Motif
Other DBs
NCBI-GeneID: 235527
NCBI-ProteinID: NP_848826
MGI: 2143267
Ensembl: ENSMUSG00000032377
Vega: OTTMUSG00000022961
UniProt: P58196 Q8BV91
Position
9; 9 E3.3
AA seq 326 aa AA seqDB search
MSGLVPTAPEQPTEEMENQIKSPTAVPDAPPDYNSHFAPGPAGPVASPSAGLPMGYYIPQ
QPGAIPLYHPTGGTHPIQYQPGKYPVTNQPAPIMWMAGPAPVPNCPPGLEYLAQLDNIHV
LQHVEPLELMTRFETNNRYDIKNNIDQMVYIVTEDTDDFTRNAYRNLRPFVLRVTDCLGR
EIMTMQRPFRCTCCCFCCPCARQELEVQCPPGVTIGFVAEHWNLCRASYSIQNEKKESMM
RVRGPCATYGCGSDSVFEINSLDGVSNIGSIIRKWNGFLSTMVNADHFEIRFPLALDVKM
KAMIFGSCFLIDFMYFERPPPRRMSR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtctggtccccacagcccctgagcaacctacagaagaaatggaaaatcaaata
aaatcaccaactgctgtgcctgatgctcctcctgactacaattctcattttgcgccaggc
cctgctggaccagttgcctctccttctgcaggcttgcctatgggatactacattccccag
cagcccggtgccatccccttgtaccatcccactggtggcacccatccaatccagtaccaa
cctggcaaatatcctgtgacgaatcagcctgctcccataatgtggatggcagggccagct
cctgtgcccaactgccctcctggtttggaatacttagctcagttggacaacatacacgtt
cttcagcatgttgagcctctggaactgatgacacgttttgaaactaataatagatatgac
atcaagaacaacatagaccagatggtctatatcgtaactgaagacacagatgactttacc
aggaatgcctatcggaacctacgaccctttgtgctccgggtcactgactgcctgggccga
gagatcatgaccatgcagaggcctttccgatgcacctgctgttgcttctgctgcccctgt
gcaagacaagagctggaagtgcaatgtcctcctggggtcaccattggctttgttgcagaa
cactggaacttgtgcagagcctcttatagcatccagaatgagaagaaagagagtatgatg
agagtgaggggtccgtgtgcaacctacggctgtggctccgattctgtttttgagatcaac
tctctagatggcgtgtctaacatcggcagtattataaggaagtggaatggctttttatca
acgatggtaaatgctgaccactttgagattcgcttccctttggccctggatgtgaagatg
aaagcaatgattttcggctcttgcttcctcattgacttcatgtactttgaacgacctcct
ccgcgacgtatgtcaagatag

DBGET integrated database retrieval system