KEGG   Mus musculus (mouse): 235534Help
Entry
235534            CDS       T01002                                 

Gene name
Pxylp1, 9430094M07Rik, Acpl2, BB177120, C130099A20Rik
Definition
(RefSeq) 2-phosphoxylose phosphatase 1
  KO
K21403  2-phosphoxylose phosphatase [EC:3.1.3.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    235534 (Pxylp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     235534 (Pxylp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 235534
NCBI-ProteinID: NP_001276574
MGI: 2442444
Ensembl: ENSMUSG00000043587
Vega: OTTMUSG00000027495
UniProt: Q8BHA9
Position
9; 9 E3.3
AA seq 480 aa AA seqDB search
MLHRNRFLVLLALAGLLAFLSLSLQFFHLIPVSATKNGGSSKSRKRIMPDPVTEPPTVDP
VYEALLYCNIPSVAEHSMEGHAPHHYKLVSVHVFIRHGDRYPLYAIPKTKRPEIDCTLVA
SRKPYHPKLEAFISHMLKGSGASFESPLNSLPLYPNHPLCETGELTQTGVVQHLLNGQLL
RDIYLRKHKLLPNNWSSDQLYLESTGKSRTLQSGLALLYGFLPEFDWKKVYFKHQPSALF
CSGSCYCPLRNQYLEKEQRRQYLLRLKNSDLERTYGEMAKIVDIPTKQLRAANPIDSMLC
HFCHNVSFPCSRSGCLGMEHFKVIKTHQIEDERERHEKLLYFGYSLLGAHPILNQTVNRM
QRAASGWRDELFTLYSAHDVTLSPILSALGLLEARFPRFAARLVFELWQDRQKPSEHSVR
ILYNGADVTFHTSFCHDFHKRSPKPMCPLENLVRFVKRDMFVALDGSSTNYYDACHGEGA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaccgtaatcgcttcttggtgctgctggccctggctgggctcttggctttcctg
agcctcagcctgcagttcttccacttgatcccagtgtctgccacaaagaatggaggaagc
agcaagagtcgaaagaggatcatgcctgacccagtgacagagcctcccaccgtagacccg
gtttatgaagctcttctgtactgcaacattccaagcgtagcggagcacagcatggaaggt
catgccccgcatcattataagctggtctccgttcatgtgttcattcgccatggggacagg
tacccactgtatgccattcccaaaacaaagcggccagaaatcgactgcactctagtggct
agcaggaagccgtatcaccctaaactagaagctttcattagtcacatgttgaaaggatcc
ggagcctcttttgaaagccccttaaattccctgcctctctatcctaaccatcctctgtgt
gagacgggagagctcacgcagacaggagtcgtgcagcatctgctgaatggccagctgctg
agggacatctatctgaggaaacacaaacttctgcccaacaactggtcctcagaccagctt
tacctggagagcacggggaagagccgcaccctgcagagcgggctagccctgctctacggc
ttcctcccagagtttgactggaagaaggtttatttcaagcaccagccaagtgccctgttc
tgctctggaagctgctactgcccgctgagaaaccagtatctggagaaggaacagcgacgc
cagtacctgctacgtttgaagaacagcgacctagagaggacctacggggagatggccaag
attgtggacatccccacgaagcagctccgcgcggccaaccccatcgattccatgctctgc
cacttctgccacaatgtcagcttcccctgcagcagaagcggctgccttggcatggagcac
ttcaaggtgatcaagacgcaccagatagaggatgagagggagcgccacgagaagctcctg
tactttgggtactccctcctcggggcccaccccatcctaaatcagacggtcaaccggatg
cagcgcgctgcctcgggctggagggatgagctgttcaccctctactctgctcatgacgtc
accctgtcacccatcctcagtgccttgggtcttttggaagccaggttcccgaggtttgcc
gccaggctggtttttgagctctggcaagaccgtcaaaagcccagtgaacattcggtccga
attctttataacggggctgatgttaccttccacacctccttctgccatgacttccacaag
cgctctcccaagcctatgtgtcctcttgagaacttggtccgctttgtcaaacgggatatg
tttgtggccctggatggcagtagtactaactattacgatgcctgtcatggggaaggggcc
taa

DBGET integrated database retrieval system