KEGG   Mus musculus (house mouse): 235542
Entry
235542            CDS       T01002                                 
Symbol
Ppp2r3a, 3222402P14Rik, A730042E07, C530025M11Rik
Name
(RefSeq) protein phosphatase 2, regulatory subunit B'', alpha
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04071  Sphingolipid signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04728  Dopaminergic synapse
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    235542 (Ppp2r3a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    235542 (Ppp2r3a)
   04151 PI3K-Akt signaling pathway
    235542 (Ppp2r3a)
   04152 AMPK signaling pathway
    235542 (Ppp2r3a)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    235542 (Ppp2r3a)
  09156 Nervous system
   04728 Dopaminergic synapse
    235542 (Ppp2r3a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    235542 (Ppp2r3a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    235542 (Ppp2r3a)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    235542 (Ppp2r3a)
   03036 Chromosome and associated proteins [BR:mmu03036]
    235542 (Ppp2r3a)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     235542 (Ppp2r3a)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     235542 (Ppp2r3a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     235542 (Ppp2r3a)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 GATase_4 DUF4116
Other DBs
NCBI-GeneID: 235542
NCBI-ProteinID: NP_001154834
MGI: 2442104
Ensembl: ENSMUSG00000043154
UniProt: B2RXC8 Q8BXX8 Q3V1Y6
Position
9:complement(100982188..101129031)
AA seq 1150 aa
MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFTHGIDCIVVHHSVCADLVHIPV
SQFKDVDLNSVFLSHENGLSSAEDYPHQALTGLPRGKKASTFQNTCNLKDIAGEAISFAS
GKIKEFSLEKLRNSNHAAYRKGRKVKSDSFNRRSVDFDLLCGHYNNDGTSPPFGLLRSSS
VEEKSLSHRNSLDTNLTSMLFQNLSEEDLVTQILEKHKIDHFSSGTDIKMCLDILLKCSE
DLKKCTDIIKQCIKKKSGGSISEGSGNEVISNSETVYMNVMTRLAYYLRKLPFEFMQSGN
NETVDLTELINNIPNLQLTPFSPLYGTEQPPKYEDIVHLSALDSGQFQTVELQDDKHNFK
QTDIVKTTPNNTDSLCSLEVNDPGTLKPVQLQSPLLTINHLENVSSGNLMETLYIEEESD
GKKSLLDKEQKAENGQGQEPLQVNEHKEFSDHDTYLKKCPVSMQNEIGKIFEKPIMVHPS
KEDSKLEVPTTDLRDQRHFVNPNSQEEIDKLLMDLESFSQKMETSLGEPLAKGKSINSLN
SHSHLTAQSHKDLEPKPIASSAMEKVSPSCLTRIIENNGHKMEEEDRALLLRIMESIEDF
AQELVECKSGRGSLSQEKEMMQILQETLTTSSQPTPSVCRSPVGEKPKDSTSVVLIQQTP
EVIKIQNKPEKKPATSFPPAATLPSSPQPASPVPCVSDVVNTPLSINIPQFYFPEGLPDT
CSNHEQILSRIETAFKDIEDQKADIHEMGRIAKVCGCPLYWKAPMFRAAGGEKTGFVTAQ
SFIAMWKKLLSNRHDDAAKFIWLLAKPSCSYLEQEDFIPLLQDVVDTHPGLTFLKDAPEF
HSRYITTVVQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFY
VIYCKFWELDGDHDLYISQADLSRYNDQASSNRIIERIFSGAVTRGKTVQKEGRMSYADF
VWFLISEEDKRNPTSIEYWFRCMDVDGDGILSMYELEYFYEEQCERMEAMGIEPLPFHDL
LCQMLDLVKPASDGRITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDGP
EPSDWDRFAAEEYEALVTEESAQVQLQEGSFEDYESDEPVSPSELGNKGNKIVTSSLSEK
CGKLQSVDEE
NT seq 3453 nt   +upstreamnt  +downstreamnt
atggcagcaacttacagacttgtggttagcactgtgaaccattatagcagtgtagtgata
gaccggcgctttgaacaagccatacattattgcactggaacctgccataccttcacacat
ggaatagactgcattgtggtgcatcatagtgtctgtgcagatctcgtgcatatccctgtg
tctcagttcaaagatgtggatctgaactcggtgtttttgtctcatgaaaatgggctttcc
tcggctgaagattatccccatcaagccctcacaggcctgcccaggggcaagaaagcatct
acatttcagaatacctgtaacttaaaggacattgcaggagaagcaattagctttgccagt
gggaaaataaaagaattttcccttgaaaaactcagaaattcaaaccatgcagcttacaga
aaaggaagaaaagttaaatctgactcatttaataggaggtcagttgattttgacttactc
tgtggccattataataatgatggaacctctccaccctttggtttactccggagttcctca
gttgaggaaaaatctttatctcacagaaattcattagatacaaacctgacttccatgctt
tttcagaacttgtctgaagaagatctagttacacagattttagaaaaacataaaatagat
catttttcttctgggacagacataaaaatgtgcttggacatcttactgaaatgctctgaa
gatttgaaaaaatgcacagacatcataaaacaatgcataaagaaaaagtcgggaggtagt
atcagtgagggaagtggcaatgaggtgatttctaactccgaaactgtctatatgaatgta
atgaccaggttagcttactacctgagaaagttaccatttgaatttatgcagtctgggaat
aacgagaccgtagatttgacagaacttatcaataatatacctaacttacagctgactcca
ttctccccattatatgggactgaacagccccctaaatatgaagatattgtccacctctca
gccctcgactccggacagtttcagactgttgaattgcaagatgacaagcataattttaaa
caaacagacattgtaaaaaccactccaaacaacacagattccttgtgtagcttggaggta
aacgatcctggaactctaaaacctgtgcagcttcagtcaccgttattaaccataaaccat
ttagagaatgtttcttctggtaacttaatggaaactctttatattgaagaggagtcagac
gggaagaagtcattattagataaagaacaaaaagcagagaatggacaaggtcaggaacca
ttacaggtaaatgaacataaagaattttcagaccatgatacttatcttaaaaaatgtcct
gtctcaatgcaaaatgaaattggtaagatatttgaaaagccaataatggttcatccatct
aaggaagattctaaattagaagttcctaccacagatctcagagaccagaggcactttgtg
aatcctaacagtcaggaagagatagacaaattattaatggatttggaatcattctcacag
aagatggagacctctctaggagaaccacttgccaagggtaaaagcatcaattctctcaat
agtcatagtcatttgactgctcagagccacaaagaccttgagcctaaacctatagcctct
tcagctatggaaaaagtttcaccttcttgtctaacaaggattattgaaaacaatggacac
aaaatggaggaggaagaccgagccctcttacttcgaattatggaaagcattgaagacttt
gctcaagagctagttgaatgcaagtcaggcagagggagcctatcacaagaaaaggaaatg
atgcaaattctacaggaaaccttgacaacttcctcccagcccactccatcagtctgtagg
agccctgttggtgagaaacccaaagatagtacttcagttgttttgattcagcagacgcca
gaagtgatcaagattcaaaataaaccagaaaagaaacctgcaacatcatttccacctgca
gccacccttccaagtagtccccagccggcctcccctgttccttgtgtgagtgatgtcgtg
aatacaccgttgtccataaacattccacagttctatttccctgaaggactcccagacacc
tgcagtaaccatgaacagatcctaagcagaattgaaactgctttcaaggatattgaagat
cagaaagcagatattcatgaaatggggagaattgcaaaggtctgtggctgtccactctat
tggaaagcccccatgttcagggctgcaggaggagagaagactggatttgtgacagcacag
tcattcattgccatgtggaaaaagttgctaagtaaccgtcatgacgatgctgccaagttc
atctggcttctggcaaagcccagctgcagctatctagaacaagaggattttatcccttta
cttcaggatgtggtagatacccaccctggcctcaccttcctgaaagatgctccagaattc
cattcccgctacatcaccacggttgttcagagaatattctacacagtcaacagatcttgg
agtggaaaaattacttcaacagagataagaaaaagcaactttttgcaaactctggccctt
ttggaggaagaggaagatataaaccaaatcacagattacttctcttatgaacatttctat
gtcatttattgtaaattctgggaactagatggtgatcatgacttgtacatcagtcaagct
gatctgtctcgatacaatgaccaggcttcatcaaatagaattattgaaagaatattttct
ggagcagtaacaagaggaaaaactgtacaaaaagagggaagaatgagctatgcagatttt
gtttggtttttgatttctgaggaagacaaacggaaccctaccagcattgagtactggttc
cgctgcatggatgtggatggagatggcatactttccatgtatgaactagagtacttctat
gaagagcagtgtgaacggatggaagccatgggcattgagcccttgccgttccatgatctg
ttgtgccagatgcttgacttggtgaagccagctagtgatggcagaataactctgcgcgat
ctgaagaggtgcagaatggcccacatcttctacgacactttctttaacctggagaaatac
ttggaccatgaacaaagagatccttttgcagtccagaaggatgttgaaaatgatggccct
gagccatctgactgggacagatttgcggctgaggagtacgaggctctcgtaactgaggag
tctgcccaggttcagctccaagaaggctcatttgaagactatgaatcagatgaacctgta
tctccctctgaacttggaaacaagggcaataaaatagtaacttcaagcctttcagagaaa
tgtggaaagcttcagtcagtggatgaagagtag

DBGET integrated database retrieval system