KEGG   Mus musculus (mouse): 235567
Entry
235567            CDS       T01002                                 

Symbol
Dnajc13, D030002L11Rik, Gm1124, RME-8, Rme8, mKIAA0678
Name
(RefSeq) DnaJ heat shock protein family (Hsp40) member C13
  KO
K09533  DnaJ homolog subfamily C member 13
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    235567 (Dnajc13)
   03110 Chaperones and folding catalysts [BR:mmu03110]
    235567 (Dnajc13)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    235567 (Dnajc13)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   235567 (Dnajc13)
SSDB
Motif
Pfam: GYF_2 DnaJ
Other DBs
NCBI-GeneID: 235567
NCBI-ProteinID: NP_001156498
MGI: 2676368
Ensembl: ENSMUSG00000032560
Vega: OTTMUSG00000049291
UniProt: G3X922 Q3TNE7 Q8BNL1 Q8CHD7
Position
9; 9 F1
AA seq 2243 aa
MNIIRENKDLACFYTTKHSWRGKYKRVFSVGTHAVTTYNPNTLEVTNQWPYGDICSISPV
GKGQGTEFNLTFRKGSGKKSETLKFSTEHRTELLTEALRFRTDFAEGKITGRRYNCYKHH
WSDAKKPVVLEVTPGGFDQINPVTNRVLCSYDYRNIEGFVDLSDYQGGFCILYGGFSRLH
LFSSEQREEIIKSAIEHAGNYIGISLRIRKEPLEFEQYLNLRFGKYSTDESITSLAEFVV
QKISPRHSEPVKRVLAVTETCLVERDPATYNIATLKPLGEVFALVCDSENPQLFTIEFIK
GQVRKYSSTERDSLLASLLDGVRASGNRDVCVKMAPTHKGQRWGLLSMPIDEEVESLHLR
FLAAPPNGNFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAITALLSQEGDVVA
SNAELESQFQAVRRLVASKAGFLAFTQLPKFRERLGMKVVKALKRSNNGVIHAAVDMLCA
LMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNSHVDHGTGALVISSLLDFLTFALC
APYSETTEGQQFDMLLEMVASNGRTLFKLFQHPSMAIVKGAGLVMKAIIEEGDREIATKM
QELALSEGALPRHLHTAMFTISSDQRMLTNRQLSRHLVGLWTADNTTATNLLKRILPPGL
LAYLDSSDPVPEKDADRMHVRDNVKIAMDQYGKFNKVPEWQRLAGKAAKEVEKFAKEKVD
LVLMHWRDRMGIAQKENINQKPVVLRKRRQRIKIEANWDLFYYRFSQDHARSNLIWNFKT
REELKDALESEMRTFNIDRELGSASVISWNHHEFEVKYECLAEEIKIGDYYLRLLLEEDE
NEESGSIKRSYEFFNELYHRFLLTPKVNMKCLCLQALAIVYGRCHEEIGPFTDTRYIIGM
LERCTDKLERDRLILFLNKLILNKKNVKDLMDSNGIRILVDLLTLAHLHVSRATVPLQSN
VIEASPDMKRESEKEWYFGNADKERSGPYGFHEMQELWAKGMLNAKTRCWAQGMDGWRPL
QAIPQLKWCLLASGQAVLNETDLATLILNMLITMCGYFPSRDQDNAIIRPLPRVKRLLSD
STCLPHVIQLLLTFDPILVEKVAILLHHIMQDNPQLPRLYLSGVFFFIMMYTGSNVLPVA
RFLKYTHSKQAFKSEETKGQDIFQRSILGHILPEAMVCYLENYEPEKFSEIFLGEFDTPE
AIWSSEMRRLMIEKIAAHLADFTPRLQSNTRALYQYCPIPVINYPQLENELFCNIYYLKQ
LCDTLRFPDWPIKDPVKLLKDSLDAWKKEVEKKPPMMSIDDAYEVLNLPIGQGLHDESKI
RKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSTKIVDGPDPENIILILKTQSILF
NRHKEELQPYKYAGYPMLIRTITMETSDDLLFSKESPLLPAAAELAFHTVNCSALNAEEL
RRENGLEVLQEAFSRCVAVLNRSSKPSDMSVQVCGHISRCYSVAAQFEECREKITEMPGI
IKDLCRVLYFGKCIPRVAALAVECVSSFAVDFWLQTHLFQAGILWYLLVYLFNYDYTLEE
SGIQKNEETNQQEVANSLAKLSVHALSRLGGYLSEDQATPENPTVRKSLAGMLTPYIARK
LAVASATETLKMLNSNTESPYLMWNNSTRAELLEFLESQQENMIKKGDCDKTYGAEFVYS
EHAKELIVGEIFVRVYNEVPTFQLEVPKEFAASLLDYIGSQAQYLHTFMAITHAAKVESE
QHGDRLPRVEMALEALRNVIKYNPGSESECIGHFKLIFSLLRVHGAGQVQQLALEVVNIV
TSNQDCVNNIAESMVLSNLLALLHSLPSSRQLVLETLYALASNTKIIKEAMAKGALIYLL
DMFCNSTHPQVRSQTAELFAKMTADKLIGPKVRITLMKFLPSVFMDAMRDNPEAAVHIFE
GTHENPELIWNDSSRDKVSTTVREMMLEHFKNQRDNPDVNWKLPEDFAVVFGEAEGELAV
GGVFLRIFIAQPAWVLRKPREFLIALLEKLTELLEKNNPHGETLETLTMATVCLFSAQPQ
LADQVPPLGHLPKVIQAMNHRNNAIPKSAIRVIHVLSDNELCVRAMASLETIGPLMNGMR
KRADTVGLACEAINRMFQKEQSELVAQALKAELVPYLLKLLEGVGLENLDSPAATKAQIV
KALKAMTRSLQYGEQVSEILSRSSVWSAFKDQKHDLFISDSQTAGYLTGPGVAGYLTAGT
SSSAMSNLPPPVDHEAGDLGYQT
NT seq 6732 nt   +upstreamnt  +downstreamnt
atgaacataattagggaaaataaggatctggcatgtttctacacaaccaagcactcatgg
aggggaaagtataaacgagtcttttcagttggaacccatgcagttactacctataatccc
aataccttagaagtaacaaatcagtggccttatggagacatttgtagcatcagccctgtt
gggaaaggacaaggaacagagttcaacctcacatttcgtaaaggcagtgggaagaagtca
gaaacgttgaagttttctacagagcacagaacagagctgcttacggaggctttgagattt
agaactgactttgcagagggaaaaatcacaggaaggagatataactgctacaagcatcac
tggagcgatgcaaagaaacctgtggttttggaagtaactcctggaggctttgaccaaata
aatcctgtaaccaacagagtgctgtgttcctatgactacaggaatattgaaggcttcgta
gatctctctgattatcagggaggattttgtatactctatggaggatttagtagattgcat
ttattttcgtcagagcaaagagaagagatcattaaaagtgcaatagaacacgctggcaac
tacataggtatctccctgcggatcaggaaagagccactggaatttgagcaatatttgaat
cttcgttttgggaaatacagcactgatgaatctatcacatctttggcagagtttgtggtc
caaaaaatatctcctcgacattcggaacctgtgaaaagagttctggcggtcacagaaaca
tgcttagtggagcgagatccagcaacctacaacattgcaacattgaagcccctgggagaa
gtatttgcattggtttgtgactcagaaaacccacaactttttaccattgagtttataaaa
gggcaagttcggaaatactcttcaacagaaagagattccttgttagcaagcttgctggat
ggagtaagagcctctggtaacagagatgtttgtgttaagatggcaccgacccacaaaggc
cagcgatgggggttactcagcatgcctatagacgaggaagtcgagagccttcacctcaga
ttcctggctgcacctcctaatggcaactttgcagatgctgtattcaggttcaacgctaac
atttcctacagtggagtgctgcatgcagtaacacaggatggtctcttctcagaaaacaag
gaaaagctaatcaataatgcaataacagcactgttgtctcaagagggggatgttgtagcc
tcaaatgcagaacttgagagccagttccaagctgtgaggaggcttgtagcctccaaagct
ggtttcctggccttcactcagcttccaaagtttcgggagcgcctaggaatgaaggtagtg
aaagcactcaagagaagcaacaacggagtcatccatgcggctgtggatatgctctgtgcc
ctcatgtgtcctatgcatgatgactatgacctaagacaagagcagctaaacaaagcttct
cttctctcttcaaagaagtttctggaaaacttattggagaaatttaattcccatgtggat
catgggaccggtgccctagtaattagttcactcttggacttccttacctttgccctctgt
gctccatatagtgagacaactgaagggcagcagtttgatatgctcttagagatggtagcc
tccaatggaagaaccctttttaaactctttcagcatccttccatggcgattgtgaaggga
gctggattggttatgaaggcaataatagaggaaggtgacagagagattgctactaagatg
caggagctcgccctaagtgagggtgccttacctcgacacttacacactgcgatgtttaca
atcagttcagatcagcgcatgcttacgaatagacagctaagtagacatctagtgggactc
tggaccgctgataacacaactgccacaaacttgttgaaacgcatattgccgccaggcttg
ttggcatacttggacagttcagatccagttccggagaaggatgcagaccgcatgcacgtc
agagacaatgtgaaaatagcaatggatcaatatggaaaatttaataaagttccagagtgg
caaagactagctggaaaagctgccaaagaagttgagaagtttgccaaagaaaaggttgac
cttgtgttgatgcactggagggataggatgggcatcgctcagaaagagaatataaatcaa
aagccagtagttcttcgaaagagaagacaaagaataaaaatagaagcaaactgggatctc
ttctattacaggtttagtcaagaccacgctagatcgaacctcatttggaattttaaaaca
cgagaagaactgaaagatgcccttgagtctgagatgcggacatttaacattgatagggag
ctgggcagcgccagtgtcatctcctggaaccaccatgagtttgaggttaaatatgagtgc
ctggcagaggaaatcaaaataggagactattacttgagattgttattggaggaggatgaa
aatgaagaaagtggatcaataaaaagatcgtatgagtttttcaatgagctctaccatcgc
ttcctgctcactccaaaagttaacatgaagtgtttgtgtttacaagcccttgctatcgtt
tacggcagatgccatgaagaaatagggcccttcacagatacgagatacatcattgggatg
ttagaaaggtgcactgataaactcgagcgggataggctgatcctcttcctcaacaagctg
atccttaataagaaaaacgttaaggatctcatggactcaaacggcattagaattcttgtg
gacttgctaactcttgcacatctccatgtgagccgagcgacagtccccttgcagagcaat
gtgattgaagcatctccagatatgaagagagagagcgagaaggagtggtattttggcaac
gcagacaaagaaaggagtgggccgtatggatttcatgagatgcaagaattatgggccaaa
ggaatgttgaatgcaaaaaccagatgttgggctcaaggcatggatggatggcgaccgctc
caggcgatacctcagcttaagtggtgcctgttagccagtgggcaggctgttctgaatgaa
actgaccttgctaccttaatactgaacatgttgatcacaatgtgtggatattttccaagc
agggaccaggataatgccatcattcgtcctctgcccagagtgaaaagactgctgtcagat
agcacctgccttccccatgtcatccagttactgctgacctttgaccctatccttgttgag
aaagttgccatcttactacatcacattatgcaagataacccacagttacctcgcctctat
ctcagcggagtgtttttcttcatcatgatgtatacaggttccaacgtgcttcctgttgct
cggtttttaaaatatacacacagcaaacaggctttcaagtctgaggagactaaaggacaa
gatatttttcagagaagtatacttggacatatcttacctgaagcaatggtttgctaccta
gaaaattatgaacctgagaagttttctgagattttccttggtgaatttgacactccagaa
gcaatctggagcagtgagatgcggcgtctcatgatagagaagattgctgcccatcttgct
gacttcacccctcgcctgcagagcaatacaagagcactttatcaatactgtcccatcccg
gttattaattatccacagctagaaaatgaactattctgtaatatttattacctcaaacaa
ctttgtgatacactccggtttccagattggccaattaaagacccagttaagcttctgaaa
gattcccttgacgcttggaagaaggaagtagaaaagaagccacctatgatgtccatagac
gatgcttatgaagtgcttaatctgcctataggccaggggctgcatgatgaaagcaagatc
agaaaagcttactttagactggcacagaaataccacccggataagaacccggaaggaagg
gacatgtttgaaaaagtaaataaagcatatgaatttctatgtaccaagtcaacaaaaata
gtggatgggccagatccagagaatataattttaattctgaaaacacagagcatccttttc
aaccgccataaagaagagttacagccttataaatatgcaggatatcccatgctaattagg
accataacaatggagacttcagatgacctcctcttctcaaaagaatcaccactgttgcct
gcggctgcagagctggctttccacacagtcaactgctcagccctcaacgctgaagagctc
aggagagagaatggcttagaggtattacaggaggcatttagtcgctgtgtggctgtcctg
aatcgctccagtaagccaagtgacatgtcagtgcaggtgtgtggacacataagcagatgc
tacagtgtggctgcccagtttgaagagtgccgggagaagatcacagaaatgcctggcatc
atcaaggacctctgccgggtgctgtattttggcaagtgtatcccacgggtggccgccctc
gcagtagaatgtgtcagctctttcgctgtggatttctggctacagacacatctatttcag
gctggaattttgtggtatctgcttgtttatctgtttaactatgactatacattggaagag
agtggcattcagaaaaatgaagaaacaaaccagcaggaagtagccaacagtcttgccaaa
ctcagtgtccatgctctgagtcgccttggtgggtatttgtctgaagaccaagcaacccca
gaaaatccaactgtaaggaagagtttagctggcatgctgacaccctacattgctcgaaag
ctagctgtagctagtgctactgagaccctgaagatgcttaacagcaacacagagagcccg
tatttgatgtggaacaactctacaagggcagaactgcttgagtttcttgagtcacaacaa
gaaaatatgatcaaaaagggtgattgtgacaaaacttatggggcagaatttgtctacagt
gaacacgccaaagaacttatcgtgggtgagatttttgttagagtctataatgaagtccca
actttccagctagaggttcctaaagagtttgctgcaagtctgttggattacataggctct
caggcccagtacctccacacgttcatggccatcactcatgctgcaaaagtggagtcggag
caacatggggaccgcttaccaagagtggaaatggctttggaggctctgagaaatgtgatc
aaatacaacccaggttctgaaagtgaatgcatcgggcactttaagttaatattttctctt
ctccgagtccatggagctggtcaagtgcagcagctggcgttagaggttgtgaatatagtg
acatccaaccaagactgtgtcaataacattgcagaatccatggttttgtccaacttattg
gctcttctacactcattgccatcgagccgtcagcttgtcctggagactctttatgctttg
gcatcaaatacaaagataatcaaagaagccatggcaaaaggagctttgatttatttattg
gatatgttctgcaattcaacacaccctcaggttcggtcccagacagctgaactttttgcc
aaaatgacagcagacaaactaataggtccaaaggtgcggattacattgatgaaatttctg
cccagcgtgttcatggatgccatgagagacaaccctgaagctgctgtgcatatatttgag
ggaactcacgaaaatccagagctgatctggaacgacagctccagagataaggtttccaca
actgtgagagagatgatgctggagcactttaaaaatcaacgggacaaccctgatgtgaac
tggaagttgcctgaagactttgctgtggtgttcggagaagcagagggggagcttgctgtt
ggaggcgttttcttgaggatctttattgcacagccagcttgggtgctgaggaaacccaga
gaatttcttattgcactgctagaaaaattaactgagctcctggagaagaacaatccacat
ggagaaactctggaaacactgaccatggcgacggtctgtctcttcagtgcacagcctcag
ttggcagatcaagtcccgccattgggccatcttcccaaagttatccaggcgatgaatcac
agaaacaatgccattcctaagagtgcaattcgggttattcacgtcctgtctgacaatgag
ctgtgtgtccgagccatggcgtccttggagaccattggcccactgatgaatggaatgcga
aagcgagcagatactgtgggcctggcctgtgaagccatcaaccgcatgttccagaaggag
cagagtgagctggtagcgcaggcattgaaagcagagttggtcccatacctcttaaagctg
cttgaaggcgtaggccttgaaaacctcgacagtcctgctgccaccaaggcccagattgtc
aaagctcttaaggcaatgactcgaagtctgcagtatggagaacaggtgagtgaaatcctc
tctcggtcttcagtctggagtgccttcaaagaccagaaacatgacttgttcatttctgac
tcccaaacagcaggatacctcacaggacctggagttgctggctaccttacagcaggtaca
tcctcatcagccatgtctaatctgccgcctcccgtagaccatgaggcaggagaccttggc
tatcagacttga

DBGET integrated database retrieval system