KEGG   Mus musculus (mouse): 235574Help
Entry
235574            CDS       T01002                                 

Gene name
Atp2c1, 1700121J11Rik, ATP2C1A, AW061228, BCPM, D930003G21Rik, HHD, SPCA, pmr1
Definition
(RefSeq) ATPase, Ca++-sequestering
  KO
K01537  P-type Ca2+ transporter type 2C [EC:7.2.2.10]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    235574 (Atp2c1)
Enzymes [BR:mmu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     235574 (Atp2c1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase_N Cation_ATPase Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 235574
NCBI-ProteinID: NP_001240763
MGI: 1889008
Ensembl: ENSMUSG00000032570
Vega: OTTMUSG00000042223
UniProt: Q80XR2 Q69ZL4
Position
9; 9 F1
AA seq 918 aa AA seqDB search
MKVARFQKIPNVENETMIPVLTSKRASELAVSEVAGLLQADLQNGLNKSEVSHRRAFHGW
NEFDISEDEPLWKKYISQFKNPLIMLLLASAVISILMRQFDDAVSITVAIVIVVTVAFVQ
EYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVD
LSVDESSLTGETAPCSKVTAPQPAANGDLASRSNIAFMGTLVRCGKAKGIVIGTGENSEF
GEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSL
AVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMT
VTHILTSDGLHAEVTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNNTL
MGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQDRPEICFMKG
AYEQVIKYCTTYNSKGQTLALTQQQRDLYQQEKARMGSAGLRVLALASGPELGQLTFLGL
VGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAIAIASRLGLYSKTSQSVSGEEVDT
MEVQHLSQIVPKVAVFYRASPRHKMKIIKSLQKNGAVVAMTGDGVNDAVALKAADIGVAM
GQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLAT
LMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILV
SSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSN
KMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVSEIIKKVERS
REKVQKNAGSASSSFLEV
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgcacgatttcaaaagatccctaatgttgaaaatgagacaatgatccctgta
ctgacgtcaaagagagcaagtgagttagcagtcagtgaggttgcaggccttctccaggct
gatcttcagaatggcttaaacaaatctgaagttagtcataggcgagccttccatggttgg
aatgaatttgatatcagtgaagatgaaccattatggaagaagtatatttctcagtttaaa
aatccccttatcatgctgctcctggcgtctgcggtcatcagcattttaatgcgccagttt
gatgatgccgtcagtatcactgtggcaatagtaattgtcgtcactgtggcctttgttcag
gaatatcgttcagaaaaatctctagaagaattgagtaaacttgtgccaccagaatgccat
tgtgtgcgtgaaggaaaactggagcatacacttgcccgagacttggttccaggtgacaca
gtttgtctctctgtgggggacagagttcctgcggacttacgcttatttgaggctgtggat
ctttctgtggatgagtctagcttgacaggagagacagctccgtgctctaaagtgacagcc
cctcagccagctgctaatggagatcttgcgtcaagaagtaacatcgccttcatggggaca
ctggtcagatgtggcaaagcaaagggtattgtcattggaacaggagaaaattctgaattt
ggagaggtctttaagatgatgcaggcagaagaagcaccaaaaactcctctgcagaagagc
atggacctcttaggcaagcagctgtccttttactcctttggtataataggtatcatcatg
ttggttggctggttactaggaaaagacattctggaaatgttcactattagtgtaagcttg
gctgtagctgcaattcctgaaggcctgcctattgtggtcacggtgactctagcccttggt
gttatgagaatggtgaagaaaagggctattgtaaagaaattgcctattgtggaaacactg
ggctgctgtaatgtgatttgttcagataaaactggaaccctgacgaagaacgagatgact
gttactcacatcctcacttccgatggcctgcatgctgaggtcactggagttggctataat
cagtttggtgaagtgatcgttgatggtgatgttgttcatggattttataacccagctgtt
agcagaattgttgaggcaggctgtgtgtgcaatgatgctgtaattaggaacaacactctg
atgggaaagccaactgaaggagccttaatcgctcttgctatgaagatgggtcttgatgga
ctgcaacaagactacatcaggaaagctgaatacccttttagttctgagcagaagtggatg
gctgttaagtgtgtgcaccgaacacagcaggacagaccagagatttgttttatgaagggt
gcttatgagcaggtgattaagtattgtactacatacaacagcaaagggcagactttggca
cttacccagcagcagagagatttgtatcaacaagagaaggcacggatgggctcagcggga
ctcagagttcttgccttggcgtctggtccggaactggggcagctgaccttccttggcctg
gtcggaatcattgaccctcctagaactggtgtgaaggaagctgtcacaacactcattgcc
tcaggagtctccatcaaaatgatcactggagattctcaggagactgcaattgccatcgct
agtcgtctgggattgtactctaagacttcacagtccgtgtctggggaagaagtcgataca
atggaggtgcagcacctttcacagatagtgccaaaggttgcagtattttacagagcaagc
ccaagacacaagatgaaaattattaagtctctacagaagaacggggcagttgtagccatg
acaggagatggggtaaatgatgcagttgctctcaaggctgcagacattggagttgcgatg
ggccagactggcaccgatgtttgcaaagaggctgcagacatgatcttggtggatgatgat
ttccaaaccatcatgtctgcaatagaagagggtaaaggcatttataataacattaaaaat
tttgttagatttcaactgagcacgagtatagcagcattaactttaatctcattggctacg
ttaatgaactttcctaaccctctcaatgcaatgcagattttgtggatcaatattataatg
gatggacccccagctcagagccttggagtagagccagtggataaagatgtcattcgaaaa
ccgcctcgaaactggaaggacagcattttgacaaaaaacttgatacttaaaatacttgtt
tcatcaataatcattgtttgtgggactttgtttgtcttctggcgagagcttcgagacaat
gtgataacaccccgagacacaaccatgactttcacttgctttgtgttttttgacatgttc
aatgcactgagttccagatctcagaccaagtctgtgtttgagattggactctgcagtaat
aagatgttctgctatgcagttcttggatccatcatgggacagttgcttgtcatttacttc
cctcctctccagaaggtttttcaaaccgagagcctgagtatactggatctgttgtttctt
ttgggccttacctcgtcagtgtgcattgtgtctgagattataaagaaggttgaaaggagc
cgggagaaggtccagaagaatgctggttcagcatcatcgtctttccttgaagtatga

DBGET integrated database retrieval system