KEGG   Mus musculus (mouse): 235582
Entry
235582            CDS       T01002                                 

Symbol
Glyctk, 6230410P16Rik, C430006L12
Name
(RefSeq) glycerate kinase
  KO
K11529  glycerate 2-kinase [EC:2.7.1.165]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00030  Pentose phosphate pathway
mmu00260  Glycine, serine and threonine metabolism
mmu00561  Glycerolipid metabolism
mmu00630  Glyoxylate and dicarboxylate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    235582 (Glyctk)
   00630 Glyoxylate and dicarboxylate metabolism
    235582 (Glyctk)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    235582 (Glyctk)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    235582 (Glyctk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     235582 (Glyctk)
SSDB
Motif
Pfam: DUF4147 MOFRL
Other DBs
NCBI-GeneID: 235582
NCBI-ProteinID: NP_001034675
MGI: 2444085
Ensembl: ENSMUSG00000020258
Vega: OTTMUSG00000034701
UniProt: Q8QZY2 A0A0R4J1H2
Position
9; 9 F1
AA seq 523 aa
MAAALQVLPCLLRAPSRPLLWGPPVARMTSGMALAEQARQLFDSAVGAVQPGPMLQRTLS
LDPSGRQLKVRDRTFQLRENLYLVGFGKAVLGMAAAAEELLAQHLVQGVISVPKGIRAAM
EHAGKKEMLLKPHSRIQVFEGAEDNLPDRDALRAALTIQQLAEGLTADDLLLVLISGGGS
ALLPAPIPPVTLEEKQMLTKLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVISLI
LSDVIGDPLEVIASGPTVASTHSVQDCLHILNHYGLRAALPRSVKTVLSRADSDPHGPHT
CGHVLNVIIGSNSLALAEAQRQAEVLGYHAMVLSTAMQGDVKRVARFYGLLARVAAAHLT
PSLAERPLEEEAELHQLAAELQLPDLQLEEALEAVVKAKGPVCLLAGGEPTVQLQGSGKG
GRNQELALHVGVELGRQPLGPIDVLFLSGGTDGQDGPTKVAGAWVMSDLISQASAESLDI
ATSLANNDSYTFFCRFRGGTHLLHTGLTGTNVMDVHLLILHPQ
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggctgcggccctacaggtcttgccctgtctcctccgagccccatcccgtccactcctc
tgggggcccccagtggcccggatgaccagtggtatggctttggcagaacaggcacggcag
ctgtttgatagtgcagtgggtgctgtgcagccaggccccatgctgcagaggacactgtcc
ctggatcctagtggcagacagctgaaggtgcgggaccggactttccagctgcgggaaaac
ctctacctagtgggcttcggcaaggccgtactgggcatggcagctgctgccgaggagctg
ctggctcagcatcttgtgcagggtgtgatcagcgtacccaaggggatccgagccgctatg
gaacatgctggaaagaaagagatgctgctgaagccacacagccgcatccaggtgttcgag
ggcgccgaggacaacttaccggatcgggatgcactccgggccgcgctgaccatccagcag
ctggcagaggggctcactgcagatgacctgctgctggtgctcatctcaggtgggggctca
gccctgctgcctgctcctatcccacctgtcacactggaggagaaacagatgctcaccaag
ctgctggcagcccgaggagccacgatccaggagctgaacaccatccgcaaggccctgtcg
cagctgaagggtggagggctggctcaggctgcctatcctgctcaggtgataagcctcatc
ttgtcagatgtgattggggaccctttggaagtgattgccagtggccctacggtggccagc
acccacagtgtgcaagactgcctgcatattctcaaccactatggcctccgtgctgctctt
ccccgctctgtgaagactgtgctctcccgagctgactctgacccccatggaccacacacc
tgtggccacgtcctcaatgtgatcatcggctctaactctctggcgctggctgaggctcag
aggcaagccgaggtgctgggctaccatgccatggtgttgagcacagccatgcagggtgat
gtaaaaagagtggctcggttctacgggctgctagcccgggtggctgcagcccacctcact
ccatccttggctgagcgtcccttggaggaggaggcggaactccatcagctggcagctgag
ctccagctcccggacctgcagctggaggaggctctggaagcggtggtaaaggctaaaggg
ccggtctgcctcctggctggtggtgagcccacggtgcagctgcagggatctggcaagggc
ggtcggaaccaagaactggccttgcacgtgggagtggagctgggaaggcagccactggga
cctattgatgtgctatttttgagtggaggcactgatgggcaggatgggcctacaaaggtg
gccggggcctgggtcatgtctgatctcatcagccaggcttctgctgagagcctggacatc
gccacctccctcgccaataacgactcatacactttcttttgccgcttccggggaggaaca
catttgctgcacacagggttgacagggaccaatgttatggatgtccacctcctgattctt
catcctcagtga

DBGET integrated database retrieval system