KEGG   Mus musculus (house mouse): 235599
Entry
235599            CDS       T01002                                 
Symbol
6430571L13Rik
Name
(RefSeq) RIKEN cDNA 6430571L13 gene
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: CEP19 Clr5 LapA_dom
Other DBs
NCBI-GeneID: 235599
NCBI-ProteinID: NP_780695
MGI: 2445137
Ensembl: ENSMUSG00000037977
Position
9:107217839..107226882
AA seq 164 aa
MNSRVPATQSWFSSHLPTTEPDLEPATAAEGSTTETATLSPETTSFNDTRIPDVAGGAAG
VGTMLLSFGIITVIGLAVAMVLYIRKKKRLEKLRHQLMPMYNFDPTEEQDELEQELLEHG
RDAASMQAAASLQVTQGKSTLPSQGPLQRPSRLVFTDVANAIHA
NT seq 495 nt   +upstreamnt  +downstreamnt
atgaactccagggtcccagctactcagagctggttcagcagccacctgcccaccactgag
cctgacttggagcccgccaccgccgctgaaggctctaccaccgagaccgccaccctcagc
ccagaaaccacaagcttcaatgacaccagaatccctgatgtggcaggtggtgcagctggt
gtgggcaccatgcttctgtcttttgggatcatcacagtgattggcctggctgtggccatg
gttttatacatcaggaagaagaagaggctggagaagctgcgccaccagctcatgcctatg
tacaactttgaccccacggaggaacaagacgagctggagcaggagctactggaacatggg
cgagacgcagcctccatgcaggctgccgcctcgctgcaggtcacacagggcaagagcact
ctcccttcccagggcccgctgcagaggcccagcaggctggtgtttaccgatgtagccaat
gccatccatgcgtga

DBGET integrated database retrieval system