KEGG   Mus musculus (mouse): 235610
Entry
235610            CDS       T01002                                 

Gene name
Atrip, 6620401K05Rik
Definition
(RefSeq) ATR interacting protein
  KO
K10905  ATR interacting protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    235610 (Atrip)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    235610 (Atrip)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    235610 (Atrip)
SSDB
Motif
Pfam: OmpH Fez1 FapA Tropomyosin_1 Golgin_A5
Other DBs
NCBI-GeneID: 235610
NCBI-ProteinID: NP_766362
MGI: 1925349
Ensembl: ENSMUSG00000025646
Vega: OTTMUSG00000033648
UniProt: Q8BMG1
Position
9; 9 F2
AA seq 785 aa
MAGTPAPNSHRKQSGGLEPFPGLSRSIENPPSKRARSFSETTVPDPEDPFGEHAEFTADD
LEELDILASQALSQCPVAPRNLSSAHKVRRLDGLPNSPIRKSREDIPVKDNFELEVLQIQ
YKELKEKLKAMEEEILIKNGEIKILRDSLRQTESVLEEQKRSHFLLEQEKTQALSEKEKE
FSRKLQSLQSELQFKDAEMNELRTKSQSNGRTNKPAAPSVSHVSPRKGSSVVLKSEACSP
HVGKTTFPTKESFSANTPLFHPCQTEAGHRFLVGQEVSDNKNHSLGGSLMKQDVQQRILA
DGWMQRKDAQGSILINLLLKQPLVPGSSLGLCHLLSSCPEVPTGTLLQPPGLSTLPGTSG
LRTISSSDGPFSPSALREAQNLAFTGLNLVARTESSHDGDMAGRRVFPLHQLPGAVHLLP
LVQFFVGLHCQALQDLAPAKKSGVPGDSATHTSCMSSGVEASPEDSIHGLESFSVASLSV
LQNLVCHSGAVVCLLLSGMGTEAAAREGNLVQTCADTTSASREDAHDQDQHPLLKMLLQL
MASSSAASGHFQASVLGLCLKVLVKLAENASSDLLPRFSCVFPVLPQCLGSALPLPCVLL
AVELLSVLLDHDSLAWQLCSHPEGCLLLRLYMYITSRPDRTASETQWLQLEQEVVWLLAK
LSVQSPAPAGIGSDCHCNVEAVRALTVMLHRQWLTVRRAGGPRTHQQKQTIRCLRDTVLL
LHSLSQKDKLFTVHCVEVLHQYDQVMPGVSMLIRALPDVTDCEEAALDDLCAAETDLEDS
EMDCN
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggccgggacccccgcaccgaacagccacaggaaacagagtggcggcctggagcctttc
cccggtctgtctcgatccattgagaaccctccgagcaagcgggcccggagcttctctgag
accacagtcccggaccccgaagacccattcggtgagcacgcggaatttactgcggacgac
ctagaggaactcgacatcctcgcgtcacaggccctgagccagtgtcccgtcgcgcctcgg
aacctgtccagtgctcataaggtccgccgattagatgggttaccaaatagtcctataagg
aaaagcagagaagatattccagttaaagataattttgaattagaagtacttcagatacaa
tacaaagaacttaaagaaaagctgaaagcaatggaagaagaaatcctaattaagaatgga
gaaattaaaattttgcgtgactctctgcgtcagacagaatccgttctagaagaacagaaa
agatcacatttccttcttgagcaagaaaagactcaagcactcagtgaaaaggaaaaggaa
ttctccagaaagctccaatcactgcagtctgaactgcagtttaaagacgcagaaatgaat
gagttaaggacaaagtctcagagcaacggacgaacaaataagccagccgctccctccgtc
tcccacgtcagtcctaggaaaggctcttctgtggttctcaagtcagaagcatgttctcca
catgttggaaaaacaactttccctacaaaagaatcttttagtgctaacacgcctctcttc
cacccctgtcagactgaggcaggacacagatttctggtgggccaagaggtttcagataat
aaaaaccacagtctgggaggtagcctcatgaagcaagatgtgcagcagagaattctggct
gatggctggatgcagagaaaagatgctcaaggttctattttgataaacttgctcctgaag
caacctttggtgccagggtcatctctaggtctttgtcaccttctgagcagttgtcctgag
gttcctactggcaccctcttgcagccaccagggctcagtactttgcctgggacttcaggc
ctcaggaccatcagttcttctgatgggccattttccccctctgccctgagagaagcacag
aacttggcattcactggattaaatctggttgccaggactgagagctcacatgatggagac
atggcaggcagaagagtcttcccgctccaccagcttcctggagctgtgcatctccttcct
cttgtgcagtttttcgtcggcttacactgccaggctctgcaagatttagccccagctaag
aagagtggggtgcctggggactctgcgacacatacctcctgcatgagctctggggtcgag
gctagcccagaggactccattcatggcttggagagcttttctgtggcatcactcagcgtc
cttcagaacctggtgtgccacagtggggcagttgtctgcctgttactgtcaggcatgggg
acagaagctgccgccagggaaggaaacttggtccagacttgtgcagatacaacctcagcc
tccagggaggatgctcatgaccaagaccagcacccactgctaaagatgcttcttcagctg
atggcttcctcctctgcagcatcaggtcattttcaagccagtgtcctgggcctgtgcctc
aaagttttggtgaaattagcagaaaacgcttcctctgatttgttgcccaggttctcctgt
gtgttcccggtgttgccacagtgcctcggctcagcgctgccgctgccctgtgtgctcctg
gctgttgagctgctctctgtgctgctggaccatgacagcctagcatggcagctatgctcc
cacccagaaggctgccttctcctgaggctgtacatgtacatcacatcaaggcctgacaga
acggcctcagagacacagtggcttcagctggaacaagaggtagtatggctcttggccaag
ctgagtgtacagagccctgcccccgctggcattggttctgactgtcactgcaatgtagag
gcagtcagagcgctcactgtgatgttgcacaggcaatggctgacggtgcggcgggcagga
ggtccaaggacccaccagcagaagcagacgatacgctgtctgcgggacactgtgctgctg
ctgcatagcctatctcagaaggacaagctcttcactgtgcactgtgtcgaggtcctgcat
cagtacgaccaggtgatgccaggggtcagcatgctgattcgagcccttcctgatgtgact
gactgtgaagaggctgccctggatgacctctgtgctgcggagactgatttggaagactct
gagatggactgtaactga

DBGET integrated database retrieval system