KEGG   Mus musculus (house mouse): 236193
Entry
236193            CDS       T01002                                 
Symbol
Zfp709, BC021921, GIOT-4, HIT-40
Name
(RefSeq) zinc finger protein 709
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    236193 (Zfp709)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    236193 (Zfp709)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    236193 (Zfp709)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 Zn_ribbon_SprT zf-C2H2_6 zf-C2H2_jaz KRAB Zn-ribbon_8 zf-C2H2_11 zf-trcl zf-met zf-C2H2_3rep C1_4 zf-C2HC_2
Other DBs
NCBI-GeneID: 236193
NCBI-ProteinID: NP_663599
MGI: 2384299
Ensembl: ENSMUSG00000056019
UniProt: Q8VC29 Q8C0I0
Position
8:72635912..72646409
AA seq 727 aa
MGSVSFQDVAVTFTVEEWALLDPSQKKLHKDVMEETFRNLAAIGKTQEGQNIDEDHRYSR
RNQRNEVVERLLEHSKGTESKEIFRQIPNTIVNRKSSHRTMLSENHVYKDNVLISQSSLT
VSVPLQTPHKPHEYELHGENLYKFGECEKAFIYPECFLKHKDSGTRQRSYELNQCEEIFK
SNDYIQIRVNDETREEICIDKQHYAFNYPDFLQYVEKVHTGKKPYACKQCGKTFSFLSNI
KRHERIHSGEKPYRCNICDKAFTCSTNFQEHERTHTGEKPYLCTQCGKSFSFLSNIRRHE
RTHTGEKPYRCNACGKAFSYLTNFQDHERTHTGEKPYVCTQCGKAFTYYYSFQTHKRCHT
GEKPYVCKQCGKAFSYYNSIQTHKRCHTGEKPYVCKLCAKAFTTLSSLRYHERIHSGEKP
HVCLQCGKGFNSSSTLRIHERTHTGEKPYKCKKCGKVFSVDSSLRCHERIHSGEKPYVCK
QCGKAFTRHTSLRCHERIHCGEKPYICKQCGKGFISSSNFRKHEWTHSGEKLCVCKLCGK
AFTGHSSLQRHERIHSGEKPYVCKHCGKDFSSLSGCQRHEQIHTGEKPYVCKNCGKAFTN
PSALRNHERIHSGEKPYVCGQCGKGFISFSKFRIHERIHTGEKPYKCKQCGKAFTGHSSL
RRHERIHSGEKPFVCKHCGKSFYTLSDCQRHEQIHTGEKPFICKQCGKAFTRSSSLKIHD
KTHSRSP
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgggctctgtgagctttcaagatgtggctgtaaccttcactgtggaggaatgggcttta
ctagatccttcccaaaagaagctgcacaaagatgtaatggaggagaccttcaggaacctg
gctgctataggaaaaacacaagaaggccagaacatagatgaggaccatagatattctaga
agaaatcaaagaaatgaagttgtggaaagactgttggagcatagcaaaggtactgaaagt
aaagaaatcttcagacagattccaaacaccattgtgaacaggaaaagttctcatagaaca
atgcttagtgaaaaccatgtgtacaaggacaacgtgctcattagtcagtcatctcttact
gtatctgtgcctcttcagactccacacaaacctcatgaatatgagctacatggagagaac
ctctataaatttggagaatgtgagaaagccttcatttatccagaatgctttctgaagcat
aaagacagtggcactagacagagatcctatgagttgaaccaatgtgaggaaatcttcaaa
agtaatgattacattcaaatacgtgtgaatgatgaaactagagaagaaatatgtatagat
aagcagcattatgcctttaattaccctgattttcttcagtatgttgaaaaggtccacact
ggaaagaaaccctatgcgtgtaaacaatgtggaaaaaccttttcttttttgagtaacatt
aaaagacatgaacggattcactctggagagaaaccatacaggtgtaatatatgtgataaa
gccttcacttgttcaactaactttcaagaacatgaaagaactcatactggagagaaaccc
tatttatgtacacaatgtggtaaatccttttcttttctgagtaacattcgaagacatgaa
cgtactcatactggagagaaaccgtacagatgtaatgcctgtggtaaggctttcagttat
ttgacaaactttcaagaccatgaaagaactcatactggagaaaaaccttacgtgtgtaca
cagtgtgggaaagctttcacttactactattcatttcagacacataaacgatgtcacact
ggtgaaaaaccctatgtatgtaagcaatgtgggaaagccttcagttactataattccatt
caaacacataaacgttgtcacaccggagaaaagccctatgtatgtaagctatgtgctaaa
gcctttactactctcagttctcttcgatatcatgagaggattcacagtggtgagaagccc
catgtatgtttgcaatgcgggaaaggtttcaattcttccagtacccttcgaatacatgaa
aggactcacactggagagaaaccctataaatgtaagaagtgtggaaaagtctttagtgtt
gacagttccctccgatgccatgaaaggattcacagtggggagaagccctatgtatgtaag
caatgtggaaaagccttcactcgtcatacctcccttcgatgccatgaaaggattcactgt
ggggagaaaccctatatatgtaagcaatgtgggaaaggttttatttcttccagtaacttt
cgaaaacatgaatggactcattctggagagaaactctgtgtatgtaaactatgtggtaaa
gccttcactggacatagttcacttcaacgccatgaaagaattcacagtggagaaaaaccc
tatgtatgtaagcattgtgggaaagatttctcttctttgagtggttgtcaaagacatgaa
caaattcacactggtgaaaaaccctatgtatgtaagaattgtgggaaagcctttactaat
cccagtgcccttcgaaatcatgaaaggattcacagtggtgaaaaaccctatgtatgtgga
cagtgtgggaagggtttcatttcttttagtaagtttagaatacatgaacggattcacact
ggagaaaaaccatataagtgtaagcaatgtgggaaagccttcactggtcacagttccctt
cgacgtcatgaaaggattcacagtggagagaaacctttcgtatgtaaacactgtgggaaa
tccttttatactttaagtgattgtcaaagacatgaacagatccacactggtgagaaacct
ttcatttgcaagcaatgtgggaaagcttttacccggtccagttcccttaaaatacatgat
aagactcacagtagaagtccctaa

DBGET integrated database retrieval system