KEGG   Mus musculus (mouse): 236266
Entry
236266            CDS       T01002                                 

Symbol
Alms1, bbb
Name
(RefSeq) ALMS1, centrosome and basal body associated
  KO
K16741  alstrom syndrome protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    236266 (Alms1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    236266 (Alms1)
SSDB
Motif
Pfam: ALMS_repeat ALMS_motif
Other DBs
NCBI-GeneID: 236266
NCBI-ProteinID: NP_660258
MGI: 1934606
Ensembl: ENSMUSG00000063810
Vega: OTTMUSG00000024144
UniProt: Q8K4E0
Position
6:85564482..85698973
AA seq 3251 aa
MEPEDLPWPDELEEEEEEEEEEGEEEEGKKEVENASAAATEEALTSEESGRLEEFEEAGP
DLDFNYESQRQESSDEEEDELAKAWLQAHPDRPGSAFSLPPPTPPPPPPPLSPRLRYTPV
EHLGKTEVVPLTCRVWQQSSYQDNSRAQFSNSSTMLLETGVRWGSEEDQRTESWHCLPQE
RDSSQTLAMSQTEIGRVEGTEVPDLPSQEGGLPAQSQCPGKKPKLNVLCSPLLVIQDNFA
APDLPLLTCLIQDQEEVEPDSLFQQSELEFAPLRGIPDKSEDSEWLARPSEVSEALIQAT
SETSSDLANSCFSISQHPLTEGLQGKAESGVLTRCGDAKYSSLYENLGAQSERIAVLQRE
VGCSNLGISQASPSSLPSFVPQEPTSEPEYHSSNLRMLRVSPDTLLTTHTHSAGSADQKI
GAAVVSSAYSQEIKPGSFHQEELPDRHLNEEIRKVSPALRTAGQKPEMLPVQSSSYSKGM
KSIFYQHPVSHGHQGKEPLSVSAVCGSAGNKAFHQLSTLSDSLLTEETWPVSVIPGLGNQ
KTPLPSEFSLSYSHRGKNLPEDVVKVSTDSGSAHKKADILTASSRTYQHKMKPANIYHQE
LPDSRVPIGTRKVAFESGPAGQKSGVSHPYGEMPSVFYQQGLPDRHSAKSPTKTFIPGPA
DQKTDLSPVPPTSSSHAEKPVSPYQLTLPGSHLPEDVFKASSVCKSSDELSGITALTSAS
YSYKGRPNSSYQQKFPDSHLNEEAQKILGTTGTVDQKTVTPTMSSSFLQKEKPSIFYQQT
LPDGGLSEEDLQVSAVPWPADQNIAIPTVTSAAFSQREKPRIFYQQTLSVDRLPGEPLNV
LGTSGPPDQNTGAPTVTPSSYFPGEESIIFYQAGFPGNTLSAMSFKVPRISGSTEQTNVT
TGSSSSYSVGEKSIIFYHQALPDGRLPQEASPAPADLNTGEPPMYLASCSVGVKPIIFYQ
QPMSDSQRTKGHKESDVPGPTDQKTGIATVHSTSQSYIGRRTVSYQKEFPDLSEKALKVL
GDVGSTEQKTQIPVVSSALLHKEGPSAYQEDLPDLTEEPLQILGVSEEVSSSSYQRKLPD
HIEVFLKSVGSGSADRKTGAQIVSSSREKSSGFHQQELPNTGGDAVDAFHPEPVVQEVRK
VQTPGAPAGPSSSHFHKEKLSDYQKASPHRDLTESSLKASTVPGLSDQKKKPAVSSGFCL
HKEKHEISASALLNCQTAELLTVTQRSCLHREDPAISTVIKPDDQKIPLPTTFHGSSDQK
VKPVIFVQKQLRDRDQSEDIPKISTVSEPTVVNTVLPVLLPGSYSHREKSDSFYPQELPD
GHLTEVDLKVSSGLGQADQISGLPTGIPGTYSHSEKHQLISEHVQELMDNLNSSESSCLS
VDSMPLNSQIDDGVIICKPESLGFANAGCEEMQNIDRGSKTLKEIQTLLMEAENMALKRC
NFSVPLVPFRDVNDVSFIRSKKVVCFKESSTTDVCTQRESFVEEVPHIEYVQKDIGTQTN
LKYQRGVGNWEFISSATFRSPLQEAEGTARMAYDETFRQYKAARSVMRSEPEGCSTGIGN
KMIIPMMTIIKSDSSSDVSDGCCSWDNNLPESLESVSDVFLNFFPYTSPKTSITDSREEE
WLSESEDGYGSTDSLAAHVKYLLQCETSLNQAKQILKNAEEEEYRVRTQAWNLKFNLGRD
RGYSISELNEDDRRKVEEIKAKLFGHGRATHMSEGLRSPQGIGCLPEAVCSRIIIESHEK
GCFRTLTAEQPRPDSCHCAFRSVEPSDLIRGHRSPSSWRGRHINLSRSIEQSNPCFKVGS
SFQLQSHPPFQKLLPDDIKISKGVGMPVHAYMDPQPSELVEPTCVPAKEMDFPSSSQILP
PEPKKQFTTAITFSSHEHSECISDSSGCKVGVTADSQCSGPSLGVFKPHIPEEQISPRDL
KQKTSFQSSLERHGSTPVTILADGSRQRQKLPVDFEHSHQKEKLLQRLGFKVSHSEPNVS
TNVSNFKGVQFSGKDTIVSQDKLTSTVEVKEKNVTVTPDLPSCIFLEQPELFEESHTPHT
DLQMRKYPSPSCPEIASRIFLEQPKLSEQSKAPHVDREIREDHSFFPKCQDYIVADPSPD
FPDQQQCKPPDVVGHTRKQNSLLSEGQDYELEEVQHIPQSYFSNMVNVEAKVSDAISQSA
PDHCTAASTPPSNRKALSCVRITLCPKTSSKLDSGTLGERFHSLDPASKTRINSEFNSDL
RIISSRSLEPTSKLLTCKPVAQDQESLVFLGPKSPLDLQVAQSSLPDSKTIFQDLKTKPP
QNSQIVTSRQTQVNISHLEGYSKPEGTPVSADGSQEQSKVSFTTSFGKLSSDAITQITTE
SPEKTTFSSEIFIHADDRGQGILDPMAQKPSRFASSSSVQQIPASHGKDAQPVLLPYKPS
GSSKMYYVPLLKRVPSYLDSKSDTTVESSHSGSNDAIAPDFPPQMLGTRDDDLSNTVNIK
HKEGIYSKRAATKGKNPSQKGDAAAPVQMPITWDENVLDENQEEVISRGVVIKMAGPEEM
SSLEKDLAGPSDITVQDRKTENLPDTKSIKQKEGSLEIESECHSAFENTAHSVFRSAKFY
FHHPVHLPHEQDFCHESLGRSVFMQHSWKDFFHHHSGHSCLPPPGPSSDKLDKTKMDYTR
IKSLSINLNLGEHEKIHTIKNQARDPKGKRQANEQKKDQKVTPELTTECPVSLNELWNRY
QERQKQQNPSGACDTKELSLVERLDRLAKLLQNPITHSLRASESAQDDSRGGHRAREWTG
RRQQKQKGKQHRKWSKSLERGQSTGDFRKSKVFSPHQGGKSSQFKIEQIKLDKYILRKEP
GFNNVSNTSLDSRPSEESVSLTDSPNIFSSTDSPVDSDVLTPTDRDMPLNERSSSISTID
TVRLIQAFGQDRLSLSPRRIKLYSTVTSQRRRYLEQPCKHNRKALNTACPQMTSEHSRRR
HIQVANHMTSSDSVSSPGSLLSLDSALSNEETVRMVSKGVQAGNLEIVAGVKKYTQDVGV
TFPTPSSSEARLEEDSDVTSSSEEKAKEKKFLSNYLQTKNLRKNKPNPCAGVSWFVPVES
GQSGSKKENLPKIYRPVISWFEPVTKTKPWREPLREQNWQAQCMNSRGSLGGPGRDSGQV
SLRPFVRATLQESLQLHRPDFISHSGERIKRLKLLVQERKLQSLFQSEREALFHSARPLP
RRVLLAVQKNKPIGKKEMIQRTRRIYEQLPEVKKKREEEKRKSEYKSYWLRAQHYKMKVT
NHLLGRKVPWD
NT seq 9756 nt   +upstreamnt  +downstreamnt
atggagcctgaggacctgccgtggcctgacgagctggaggaggaggaggaagaagaggag
gaggagggcgaggaagaggaggggaagaaagaggtggagaacgcctcggcggcggcgacc
gaggaggccctgacctctgaggagagtgggagactggaagagttcgaagaggcggggccc
gacttggattttaactacgagtcccagcggcaggagagctcggacgaagaggaggacgag
ctggctaaagcctggctgcaggctcaccccgaccgtcctggcagtgctttctctctgccc
cctcccacgcctccgcctccgcctccgcctctgtccccgcggctccggtacaccccagtg
gagcatctgggcaagactgaggttgtcccactgacttgccgtgtatggcagcagtcatca
tatcaagataattctagagcccagttttccaactccagtacaatgttattggaaacaggg
gtccggtggggctctgaggaggatcagagaacagagtcttggcattgtcttcctcaagaa
agggattcttcccaaaccttggctatgtcccagactgagatcggcagagtagaaggaaca
gaagtaccagacctaccctctcaggagggaggtttaccagctcagtcacagtgtccagga
aagaagccaaagctgaatgtcttgtgttctccattgctagtgatacaggataactttgct
gctcctgatttgcctttgctgacatgtttgatacaagaccaagaagaggttgagcctgat
tccttgtttcaacaaagtgaactagaatttgcacctttgagaggaattcctgataagtct
gaagattctgaatggcttgctcgaccatcagaagttagtgaagctttaatccaagccacc
tcagaaacatcttcagacttagctaacagttgctttagtatatctcagcatccacttaca
gagggcctgcaggggaaggctgaatctggtgtccttactaggtgtggtgatgctaagtac
tccagcctttatgaaaaccttggtgcacagagtgaaagaattgctgtattgcagagagag
gtaggttgttctaatctgggcattagccaggcttctccatcttcattgccttcatttgtt
cctcaagaaccaaccagtgagccggaataccattcctccaatctcagaatgttgagggta
tctcccgacactctgctaacaacgcatacacattcagcaggatctgctgaccagaagatt
ggagcagcagtagtctcttctgcttactcacaggaaataaagcctgggagttttcaccaa
gaagagttgccagataggcatcttaatgaagagattcggaaagtgtcacctgctcttagg
acagctggccagaagccagagatgctaccagtacaatctagttcttactctaaaggaatg
aaatctattttctatcaacatcctgtgtcacatggccatcaaggcaaagagcctctaagt
gtttcagctgtttgtggatcagctggtaataaagctttccaccagctttccacattatca
gacagtctactaactgaagaaacatggccagtttctgttattcctggcctaggtaaccag
aagactcctttaccatcagaattctctctttcatattctcatagaggaaagaacctgccc
gaagatgttgtgaaagtttccactgattctggatctgctcacaagaaggctgacattcta
acagcgtcctctagaacctaccagcacaaaatgaaacctgctaatatttaccaccaagag
ttgccagacagtcgtgtacctatagggactagaaaggttgcatttgaatctggaccagct
ggccagaagtctggggtttctcacccatatggtgagatgcccagtgttttctatcagcag
gggttgccagataggcattcagcaaaaagccctacaaaaacctttatcccaggaccagct
gaccagaagactgatctatcaccagtaccccctacttcctcttcgcatgcagagaagcct
gtttccccctaccagttaaccttgccaggtagtcatctacctgaagatgttttcaaagct
tcttctgtttgtaagtcatctgatgagctatctggaataacagctctaacctctgcttcc
tactcatataaagggagacccaatagttcttatcagcagaagtttccagacagccaccta
aatgaagaggcccagaaaatcttgggtacaactggaacagtagaccagaagacagtgaca
ccaacaatgtcttcttcctttttacaaaaagaaaagcctagtattttctaccaacaaacc
ctgccagatggtggtctgtctgaagaggatctgcaggtttcagctgttccttggccagct
gaccagaacattgctataccaacagtaacttctgctgctttctcacaaagagaaaagcct
cggattttctaccaacagactctgtcagttgatcgtttgcctggagagcctctgaatgtt
ttagggacttctggaccacctgaccagaacactggggcaccaacagtaactcctagttcc
tacttccctggagaagagtccattattttttaccaagctggctttccaggtaacactctg
tctgcaatgtcttttaaagttccaaggatttctggatcaactgaacagactaacgtaaca
acaggatcatcaagttcctactcagttggagagaagtccattattttctaccatcaggcc
ttgccagatggtcgtcttcctcaagaagcttctcctgcaccagctgacctaaacactggg
gagccaccaatgtatttggcttcctgttctgttggagtaaagcccattattttctaccag
cagcctatgtcagatagtcagcgaactaaaggtcacaaagaatcagatgttcctggacca
actgaccagaagactggcatagcaacagtgcattctacttcccaatcatatatagggagg
cgcactgtttcttaccagaaagagtttccagatcttagtgaaaaggctttgaaagttcta
ggtgatgttggatccactgaacagaaaactcaaataccagtagtgtcttctgctctctta
cacaaagaggggcctagtgcttaccaggaggatttgccagatcttactgaagaacctttg
caaattttaggtgtttctgaagaagtttcttctagctcttatcagaggaagttaccagat
catattgaagtatttttgaaatcagtaggctctggctctgctgatcggaagactggggca
caaatagtctcctcaagtagagagaagtccagtggttttcatcagcaggagttgccaaat
actggtggggatgcagtagatgcttttcatcccgaaccagttgtccaggaggtcaggaag
gtacagacgcctggggcaccagcaggaccttctagttcccacttccataaagaaaaactc
agtgattatcaaaaggcctcgccacatcgtgatctaactgaaagttctttgaaggcttca
actgttccaggactatctgatcagaaaaagaaacctgcagtctcatctggtttctgctta
cacaaagagaaacacgagatttcagcttcagctttgctgaattgccagacagccgagttg
ctaacagttactcagaggtcctgtttacatagagaggatcctgcaatttcaactgtgatc
aaaccagatgaccaaaagattccattaccaacaacttttcatggctccagtgatcaaaaa
gtaaaacctgttatttttgttcaaaaacagttacgagatagagatcaaagtgaagatatt
ccgaagatttcaactgtctctgagccaactgttgtaaatacagttctaccagtacttctg
cctggttcttactcacacagagagaagtcagattcattttacccacaggaactgccagat
ggacatctaactgaagttgatctgaaggtttcaagcggtcttggtcaagctgaccagatt
tctgggttacctacaggtattcctggtacttattcacacagtgaaaagcaccagcttatc
tcagaacatgtccaagagctgatggataacttgaattcttccgagtcgtcttgtctcagt
gtggatagtatgcctctaaattcacaaatcgatgatggagttatcatatgtaagccagaa
tctttaggttttgccaatgctggctgtgaggaaatgcagaatatagatcgtggttcgaaa
actcttaaggaaattcagactctcttgatggaagcagaaaatatggcactgaaacgatgc
aatttctctgttcccttagtccctttcagagatgttaacgatgtttcatttatacgatca
aagaaggtggtttgcttcaaagaatcctccacaactgatgtttgtacccagagggaatca
tttgtagaagaagttccacacattgaatatgtacagaaggacattggcacacagacgaac
cttaagtaccagaggggtgttggaaattgggaatttatcagttcagctacctttagaagt
cctctacaggaagcagaaggcacagctagaatggcatatgatgaaacttttaggcaatat
aaagctgccaggtctgtaatgaggtctgaacctgaaggctgcagtacaggcattgggaat
aaaatgattatccctatgatgacaatcataaagagtgactcgagtagtgatgtaagtgat
ggttgctgctcatgggacaacaatttaccagagtctttggaatctgtttctgatgttttt
ctaaacttctttccatatacttcacccaagacaagtataacagatagccgagaagaggag
tggttgtcagagagcgaggatggctatggtagtacagattcattggctgcacatgtgaag
taccttctgcagtgtgaaacttcactgaatcaagccaaacagatacttaaaaatgcagag
gaagaggaatatcgggtccgaacccaagcctggaatctaaagtttaatttaggacgtgac
cgtggatactccatttcagaattaaatgaagatgacagaaggaaagtagaagagataaaa
gcaaagttgtttggtcatggaagagcaactcacatgtctgagggcttacgaagtccacaa
ggcataggatgtttgccagaagctgtatgtagtcgaattattattgagagccatgagaaa
ggatgtttcaggactcttactgctgaacaaccacggccagacagctgccattgtgctttt
cgatctgttgaaccttcagacttgattagaggacatcggagcccatcatcatggagaggc
aggcacatcaacctttccagatcaatagaacagagcaatccctgtttcaaagtagggagt
tcctttcagttacagagtcatcccccatttcaaaaacttttacctgatgacatcaaaatt
agcaagggtgttggaatgccagtccatgcatacatggatccccagccatcagaattagta
gaacctacttgtgtgccagctaaagaaatggattttccttcctcatctcaaatactgccc
cctgagcccaagaagcagttcactactgccatcactttttcttctcacgaacactctgag
tgcatttctgattcctctggttgtaaggttggtgttactgcagatagccagtgtagtgga
ccatctttaggggtatttaagcctcatatccccgaagagcagatttctcctagagatctt
aaacagaaaacctctttccagtcatcacttgaaaggcatggttctacaccggtgactatt
ttagctgatggtagtaggcaaaggcaaaaattacctgttgattttgagcattctcatcaa
aaagaaaaactcttacaaagattaggttttaaagtcagccattctgaacccaatgtcagt
acaaatgttagcaatttcaagggagttcaattttctggtaaggataccattgttagccag
gacaaactaacttctacagtagaggtaaaagagaagaatgtaactgtaactcctgatctt
ccttcttgcatttttcttgaacaaccagagctctttgaggaaagccacaccccacataca
gatcttcagatgagaaaatacccttctccctcttgtccagaaattgcttctcgcattttt
cttgagcagccaaaactctctgaacaaagcaaagccccacatgtagatcgtgaaataaga
gaagatcactctttctttcctaagtgccaggattatatagttgcagacccttctcccgat
tttcctgatcagcaacaatgcaaacctccagacgtagttggccacacgagaaaacagaac
tctcttctttctgaaggtcaggattatgagttagaagaggttcagcatatacctcagtca
tacttttctaatatggtaaatgttgaagccaaggtcagtgatgcgatctcccagtcagcc
cctgaccactgtacagctgcatctactccaccttcaaatagaaaagcactttcatgtgtt
cgtataactctttgtcccaagacttcttccaagttggatagtggaaccttaggtgaaagg
tttcattcattggatcctgcttctaaaacaaggattaatagtgagtttaactctgatctg
cgaattatatcttcaaggtcattggaaccaacctccaaattactgacctgtaaaccagta
gcacaggatcaagaatctttagtttttctaggacctaaatctccactggacttgcaagtc
gcacagtcttctcttccagatagtaagactatttttcaggacttgaaaaccaaacctcct
cagaatagccagatagtaacctcaaggcaaacacaagtgaacatttcacatttggaagga
tattccaaaccagaggggactccagtatctgcggatggttcacaagaacagagtaaggtt
tcctttactacgtcctttggaaagttatcatctgatgccatcactcagataacaacagaa
agtccagaaaagaccacattttcatctgaaatttttattcatgcggatgatcgtggacag
ggcattctagaccccatggcccaaaagccatccaggtttgcctcatcatcctcagtgcag
caaatcccagcttctcatggcaaagacgcccagcctgtgctgttaccatataagccatct
ggtagttcgaagatgtattatgttccactgttaaaaagagttccttcatatctggattcc
aaatctgataccactgttgagagctcacattcaggctcaaatgatgctattgccccagac
tttccacctcaaatgctaggcacaagagacgatgacctctccaacactgtaaacattaag
cacaaagaagggatttatagcaagagggctgcaacaaaggggaaaaacccctctcagaaa
ggtgatgcagcggccccagttcaaatgcctataacttgggatgagaatgtcttggacgaa
aaccaagaagaggtcatcagtagaggagttgtgatcaagatggcaggacctgaagaaatg
tcatccctggagaaggaccttgcaggtcccagtgatatcactgtacaagacagaaaaact
gaaaatctgccagacactaaatccattaaacagaaggaaggatccttagagatagaatct
gaatgtcattctgcatttgaaaacactgctcactctgtcttcagatcagccaagttttat
ttccatcatccagtgcacctgccccatgagcaagacttctgccatgaatctttgggaagg
agtgttttcatgcaacattcttggaaggatttctttcaccatcattcaggacacagctgc
cttcctccccctggcccaagttcggacaagttggacaagaccaagatggattacaccaga
attaagagcctcagcatcaacttgaatttgggagagcatgagaaaatacatactatcaag
aatcaggccagagacccaaaaggcaaaagacaagcaaatgagcaaaagaaggatcagaag
gtcaccccagagctaacaactgagtgccccgtgagtttgaatgaactctggaacagatac
caggagcgacagaagcagcagaatccatctggtgcttgtgatacgaaagagctctccttg
gtggaacgacttgatcgcttggctaaactgcttcagaatcccatcacacattcactccgg
gcctcagaaagtgcacaggatgatagcagagggggacatagagccagggagtggactggg
aggaggcaacaaaaacagaaaggcaagcaacacaggaagtggagtaagagcctagagagg
ggccagagtacaggggactttaggaaaagcaaagtgttttctcctcatcaaggtgggaaa
tccagtcagttcaagattgagcagattaaactagataagtacatcctgaggaaagagcca
ggttttaataatgtcagcaatacctccttggattctagaccctcagaggaaagcgtgtct
ctcacagatagtcccaacattttttctagcacggattctcctgtggactcagatgtattg
accccaactgatagggacatgcctttaaatgagaggagcagctccatatccaccattgac
acagtccggttgatccaggcttttggccaagatagactgtctttgtcgcccaggcgaatt
aaattatacagtactgtcactagtcaacggaggagatatctggagcagccatgcaagcac
aacaggaaggcattgaacacagcctgtccccaaatgacttctgagcacagcagaaggagg
cacatccaggtggcaaaccatatgacttcttctgactctgtttcatctcctgggagcttg
ttgagcttggactctgctctttccaatgaggaaactgtacgcatggtgagcaagggtgta
caagctggtaacttggagattgtggctggtgtcaaaaaatacactcaggatgttggggtg
actttcccaactcccagttctagtgaggccagattggaagaggacagtgatgtgacttct
tcgtcagaagaaaaagccaaagagaaaaagtttctttccaattatctgcagaccaaaaac
ttaaggaagaacaagccaaatccctgtgcaggagtctcatggtttgttcctgtggaaagt
ggacaatcaggatctaagaaggaaaacctgcccaagatttacagacctgttatctcctgg
tttgaaccagtaaccaaaaccaaaccctggagggagccactgagggaacaaaactggcag
gcccaatgcatgaacagtcgtgggtccctgggaggcccaggcagggatagtggccaggtt
tctcttcggccatttgtgagagcaactctgcaggaatcacttcagcttcacagacctgat
ttcatctcccactctggggagcgcataaagcgtctgaagttacttgtccaggagaggaag
ctccagagcctgttccagagtgagcgggaggctctgttccactcagcgaggcccctgccc
aggagagtcctcctggctgtccagaagaacaagcctattggaaagaaggaaatgattcag
aggaccagacgaatttatgagcagcttccagaagtgaagaagaagagagaagaggagaag
agaaaatcagaatataaatcctactggctacgtgctcaacactataaaatgaaagtgacc
aatcatctcctggggagaaaagtgccttgggactga

DBGET integrated database retrieval system