KEGG   Mus musculus (mouse): 236312
Entry
236312            CDS       T01002                                 

Symbol
Ifi209, 4930422C14, AI447904, If, Ifix, Pyh, Pyhi, Pyhin-1, Pyhin1
Name
(RefSeq) interferon activated gene 209
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: HIN PYRIN
Other DBs
NCBI-GeneID: 236312
NCBI-ProteinID: NP_778191
MGI: 2138243
Ensembl: ENSMUSG00000043263
Vega: OTTMUSG00000050198
UniProt: Q8BV49
Position
1; 1 H3
AA seq 420 aa
MVNEYKRIVLLTGLMGINDHDFRMVKSLLSKELKLNRMQDQYDRVKIADLMEDKFPKDAG
VDQLIKLYKQIPGLGDIANKLKNEKAKAKRTRTGKRKTAAKRQRQEEPSTSQPMSTTNED
AEPESGRSTPDTQVAQLSLPTASRRNQAIQISPTIASSSGQTSSRSSETLQSIIQSPKTP
KRPSSSILDPPVSSGTASSSAQALGVPLATIAKRQRLKNVPKEPSEENGHQQGSKKVMVL
KVTEPFSYDVTEEKMFHATVATETEFFRVKVFDIVLKEKFIPNKVLTISNYVGCNGFINI
YSASSVSEVNDGEPMNIPLSLRKSANRTPKINYLCSKKRGIFVNGVFTVCKKEEKWNYIC
YEIGDDTGMMEVEVYGRLTNIACNPGDKLRLICFKLIPDEEKAQLRSTTHSNMQVIKAKN
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggtgaatgaatacaagagaattgttcttctgacaggattaatgggtattaatgaccat
gattttagaatggttaagtccttgttgagcaaagaactaaaactaaatagaatgcaagat
cagtacgacagagttaagattgctgatttgatggaagacaagttcccaaaagatgctgga
gtggaccaactgataaaactatataagcagattccaggacttggagacattgctaataaa
ctcaaaaatgagaaggcaaaagctaaaaggacacggacagggaaacggaaaaccgcagca
aaaagacaaaggcaagaagaacccagtacttcccaacctatgtccaccacaaatgaagat
gcagaaccagaatcagggaggagtacacctgacacacaggttgctcagttatctttacca
actgcttcccgaaggaaccaagccattcaaatttctccaacaatagcatccagcagtggt
cagaccagcagcagatcttcagaaacattacaaagcatcattcagtcccccaaaactcca
aaaagaccgtccagcagtattctggaccctccagtgtcttcaggaacagcatccagcagt
gcccaggcactaggagttcctctagcaacaatagccaagagacagagactgaaaaatgta
cccaaagaaccttctgaggaaaatggtcaccagcaaggttccaaaaaagtgatggtgtta
aaagtaacagaaccattttcatatgacgtgacagaagagaagatgttccatgccaccgtg
gctacggaaacagaattctttagagtaaaggtgtttgacattgtcctgaaggagaagttc
ataccaaataaggtccttaccatctcaaactatgttggctgcaatgggttcataaatata
tacagtgcatctagtgtgtcagaggtaaatgatggcgaaccaatgaatatcccactttca
ctgaggaaaagtgccaatcgaacacctaaaatcaactatctttgctcgaagaaaagagga
atatttgtgaatggagtgtttactgtatgtaagaaagaagaaaagtggaactacatttgc
tatgagataggagatgatacagggatgatggaagtggaggtctacggacgactgaccaat
attgcttgtaatcctggagataaacttagactcatatgctttaaactgatcccagatgaa
gaaaaagcacagctgagatctacaacacacagtaacatgcaggttatcaaagctaagaat
tga

DBGET integrated database retrieval system