KEGG   Mus musculus (mouse): 236537
Entry
236537            CDS       T01002                                 

Gene name
Zfp352, 2czf48
Definition
(RefSeq) zinc finger protein 352
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4
Other DBs
NCBI-GeneID: 236537
NCBI-ProteinID: NP_694742
MGI: 2387418
Ensembl: ENSMUSG00000070902
Vega: OTTMUSG00000007775
UniProt: A2AML7
Position
4; 4 C5
AA seq 551 aa
MEMAENTGASQPGPCNTQPSPVESSQLFSGQSSEMLTWKQTVMESASCSTQETTCTQNST
AYPGKAIGFHFGQPFENTSWNQQVVSAEQKISPAGLYHTQLNSAPQICLPPQKTTRVDTR
ETFYNEDYWMRTLNSDKTLLTQNTAMCENQRVTFDNHQIALYGSHAGQDPNVGHAFASEH
DWTSYNSHMTTRNGGHLTLYESQMTAPSCSQTLHPNQIITSFSEQNYFEDQQSNLAVNNG
FYGNQVILPNGYQAFYEPQMRANFDQTNDQMKSFSGQNVCKGQENLLSGECSLSGYQTSG
YRCDQDLIVNPQVTSPIGGQPLSDFQTQTSSFDTALPGSKRTRPSAEDNLACPLETSPTS
EETLYLGQMRTSVDQNFYSSQNGTPNIKESLDPQVTSFSLQAPYVGESSYPSCSPLIQKQ
PQKNSSASSLVQRQHPEMKLDFKTQSPVSQKDPSPLKLYFCTYKGCTKFYKRAYHLKEHQ
KKHTDKRKYGCDEPGCTWSFFRLCDLNRHKEKHNGERFYACPLCSTNYSRLLYLKKHLEK
KHAQAQPTTAT
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggagatggcagaaaacacaggtgcttcccagccaggaccctgcaatacacagccttcc
cctgtggagtccagccagcttttctcaggtcagagctcagagatgcttacctggaaacaa
acagtgatggaatctgcatcctgtagcacacaggagacaacctgtactcagaactcaaca
gcatacccaggaaaagccattggtttccattttggacagccatttgagaacacttcttgg
aaccagcaagttgtgtctgctgagcagaaaatatctcctgcaggtctttaccatacacag
ctcaacagcgcccctcagatatgccttcctccccagaagacaacaagagttgacaccagg
gagactttctacaatgaagactactggatgaggacactgaactctgacaagactctcttg
acccaaaatacagccatgtgtgagaatcagagggttacctttgataatcatcaaattgct
ctctatggaagccatgctggccaggacccaaatgtgggtcacgcctttgcttctgaacat
gactggacctcctacaacagtcatatgacaaccaggaatggagggcatctgactctctat
gagagtcagatgacagcacccagttgtagccagacccttcatcccaatcaaatcataaca
tccttttctgaacagaattattttgaggatcagcagagtaacctagcagttaataatgga
ttctatggaaatcaggtgatattgccaaatggataccaggctttctatgagcctcagatg
agagctaactttgaccaaacaaatgaccaaatgaaatccttcagtggtcagaatgtctgc
aaaggtcaggagaatctcctcagtggtgagtgctccctctctggttatcagacatcaggc
tacagatgtgaccaggatttgattgtgaatcctcaggtgacaagtccaattggtggccag
cctctctctgactttcagacacaaacctcaagttttgatacagctcttcctgggtctaag
aggacaagacccagtgcagaagacaacctggcttgccctttggagacaagtcccacatct
gaagaaacactctacttgggtcagatgaggacctctgttgatcaaaatttctactcaagt
cagaatggaacacctaatattaaagaaagccttgatcctcaggtgacttcatttagtttg
caagctccatatgtgggtgaatcctcatacccttcatgttcccctttgattcaaaaacaa
cctcagaaaaactcttcggcttccagtttagtccagagacagcatccagagatgaagtta
gacttcaagacccagagccctgtgtcacagaaggaccctagtcctttgaagctctacttt
tgtacttataagggttgtacgaaattttacaaaagagcttaccacctcaaagaacaccag
aagaaacacactgataagaggaaatacgggtgtgatgagcctgggtgcacatggtcgttt
ttccgcctatgtgatctcaacagacacaaagaaaagcacaatggtgagaggttctacgct
tgtcccttgtgctctacaaactattccagactgctttatctcaaaaagcatctggagaag
aaacatgctcaagcacaacccaccactgcaacctga

DBGET integrated database retrieval system