KEGG   Mus musculus (mouse): 236539Help
Entry
236539            CDS       T01002                                 

Gene name
Phgdh, 3-PGDH, 3PGDH, 4930479N23, A10, PGAD, PGD, PGDH, SERA
Definition
(RefSeq) 3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00260  Glycine, serine and threonine metabolism
mmu00270  Cysteine and methionine metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01230  Biosynthesis of amino acids
Module
mmu_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    236539 (Phgdh)
   00270 Cysteine and methionine metabolism
    236539 (Phgdh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    236539 (Phgdh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     236539 (Phgdh)
    1.1.1.399  2-oxoglutarate reductase
     236539 (Phgdh)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   236539 (Phgdh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh
Motif
Other DBs
NCBI-GeneID: 236539
NCBI-ProteinID: NP_058662
MGI: 1355330
Ensembl: ENSMUSG00000053398
Vega: OTTMUSG00000026317
UniProt: Q61753
Position
3; 3 F2.2
AA seq 533 aa AA seqDB search
MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVT
ADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQ
IPQATASMKDGKWDRKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTVGYDPIISP
EVAASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDSTFAQCKKGVRVVNCARGGIV
DEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIA
VQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEAMGTLMHAWAGSPKGTIQVVTQG
TSLKNAGTCLSPAVIVGLLREASKQADVNLVNAKLLVKEAGLNVTTSHNPGVPGEQGSGE
CLLTVALAGAPYQAVGLVQGTTPMLQMLNGAVFRPEVPLRRGQPLLVFRAQPSDPGMLPT
MIGLLAEAGVQLLSYQTSMVSDGEPWHVMGLSSLLPSLETWKQHVLEAFQFCF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgcaaatctgcgcaaagtactcatcagtgacagcctggacccctgctgccgg
aagatcctgcaagatggagggctgcaggtggtggagaagcagaacttgagcaaggaggag
ctgatagctgaactccaggactgtgaaggcctcattgtccggtctgctactaaggtcact
gctgatgtcatcaatgcagcagagaagctccaggtggtgggcagggctggcacaggtgtg
gacaatgtggatctggaggctgccacgaggaagggcatcctagtcatgaacacccccaac
gggaacagcctcagtgctgcggagctcacctgtgggatgatcatgtgcctggccaggcag
attccccaggcaacagcttcgatgaaagatggcaaatgggaccggaagaagttcatgggg
acagaactgaacgggaagacactgggaattcttggcctcggcagaattggaagagaggtg
gccacccgaatgcaatcctttggaatgaagactgtaggctatgaccccatcatctctcct
gaagtcgccgcctcctttggtgttcagcagctgccgctggaggagatctggcctctctgt
gactttataactgtccataccccactcctgccctctaccacaggcttgctgaatgacagc
acctttgctcagtgcaagaaaggtgtgcgagtagtgaactgtgctcgaggaggcattgtg
gatgaaggtgccctgctgcgtgccctgcagtctggtcagtgtgctggggctgcactggat
gtgtttacagaagagccaccacgggaccgggccttagtggaccacgagaatgtcatcagc
tgtccccacctgggtgccagcaccaaggaagcccagagccgctgtggggaggaaatcgca
gtccagtttgtggacatggtgaaggggaaatctctaacaggcgttgtgaacgcccaggcc
ctcaccagtgccttctctccacacaccaagccttggattggtctggcagaagcaatgggc
acgctgatgcacgcctgggctggctcccctaaagggaccatccaggtggttacacaagga
acatctctgaagaatgctgggacctgcctgagccctgcagtcattgtcggccttctgaga
gaagcatctaagcaggcagacgtgaacttggtgaacgctaagctactggtgaaagaggct
ggcctcaatgtcaccacctcccacaaccctggggttccaggggagcagggtagcggggaa
tgcctcctgactgtggccctggcaggtgctccctaccaagccgtgggcttggtccagggc
accacaccaatgctgcagatgctcaacggagctgtcttcagaccagaggtgccactacgc
aggggccaacccctgctcgtattccgggctcagccctccgaccctgggatgctgcccact
atgattggcctcctggcagaggcgggtgtacagctgctgtcctaccaaacctccatggtg
tctgacggagagccctggcacgtcatgggcctgtcctccctgctgcccagcctggaaaca
tggaagcagcatgtattggaggctttccagttctgcttctga

DBGET integrated database retrieval system