KEGG   Mus musculus (mouse): 236643
Entry
236643            CDS       T01002                                 

Symbol
Sytl5, slp5
Name
(RefSeq) synaptotagmin-like 5
  KO
K17598  synaptotagmin-like protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    236643 (Sytl5)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    236643 (Sytl5)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     236643 (Sytl5)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    236643 (Sytl5)
  Small GTPases and associated proteins
   Rab associated proteins
    236643 (Sytl5)
SSDB
Motif
Pfam: C2 FYVE_2
Other DBs
NCBI-GeneID: 236643
NCBI-ProteinID: NP_808372
MGI: 2668451
Ensembl: ENSMUSG00000054453
Vega: OTTMUSG00000017464
UniProt: Q80T23 A2AF58
Position
X; X A1.1
AA seq 753 aa
MSKNSEFINLSFLLDHEKEMILGVLKRDEYLKKVEDKRIRKLKNELLEAKRRSGKTHQEA
SRVCVHCHKTLGLIFDRGDPCQACSLRVCSECRVTGLDGSWKCTVCAKVAQLRIISGEWF
LEEKAKRFKQVNVLGTDVVRQSILRRSPGSEETQNQEQAQQCVDKSDTLSSVRQKTTHDG
PKKKGFLLSKFRSATRGEIRTPKPESGRSYSLDLDSQNLQSFKSASGSDRGSTTSSDLID
QEAGRRTSKSSYSNGGIPVTQRSPVPSAHSVTSINSREHGFENSMALATIENTCEELTKS
HRRNTSGTPSIAVSGTSLSSERSRSEVDLSESFAEDLEDTSSIRSRSVPGALDKDLNSLE
DTEDGVDLVSSRFSANTHSLASGLSTNSQAGSDRKRSYLNVPDADSDTTSLNSMMSVYSE
TGDYGNVKVTGEILLHISYCYKTGGLYIFVKSCRNLATGDEKKQRTDAYVKSYLLPDKSR
NNKRKTKIRTGTNPEFNETLKYTISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIAFDSW
NFENPCDEWFVLQPKVELAPDISLQYKGELTIVLRYIPPEENLIFPAGQRQEKKIFKRGK
KKESSSISGGILEVFIKKAKNLTAVKSGGTSDSFVKGYLLPDDNKATKHKTAVVKKSVNP
EWNHTFIFSGLYPQDIKNACLELTIWDKEAFSSNVFLGGVRLNSGSGMSYGKTVDWMDSH
GEEQRLWQKMADNPGTSVEGVLMLRSSMAKCRL
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgtctaagaactcggagttcatcaatctgtcatttttattagatcatgagaaggaaatg
atactgggagtcctaaagagagatgaatatttgaaaaaggtggaagacaagaggataagg
aagctgaaaaatgaactcttagaagcaaagcgtaggagtgggaagactcaccaagaggcc
agtagagtctgcgttcactgtcacaaaacccttggcctcatctttgaccggggagatcca
tgccaagcctgctcactcagggtatgcagtgagtgtcgagtcaccggacttgatggcagc
tggaagtgcactgtctgtgccaaagtcgcgcagctaaggattataagtggagaatggttc
ttggaagaaaaggcaaagcgtttcaagcaagtcaatgttctgggcactgatgtcgttcga
cagtccatcttaagaagaagtccagggtctgaagaaacacaaaaccaagagcaagcacaa
caatgtgtagacaagtcagatactttgtcttctgtcaggcagaagacaactcatgatggc
ccaaagaagaagggttttcttcttagcaagttcagatcagcaaccagaggagaaatcaga
actccaaaacctgaaagcggaaggagctatagcttggacttagacagtcaaaatcttcag
agtttcaagtcagcctctggttcagacaggggaagtaccacttcatcagatctcattgac
caggaggctggacgaagaacatcaaaaagcagctacagcaacggtggaatcccagttact
cagaggtcaccagtcccaagtgctcatagtgtgacctccatcaacagcagagaacatggt
tttgaaaattccatggctttggctaccattgaaaacacctgtgaagagctcacaaagagt
caccgcagaaacacatccggtacaccctccatagcggtgtctggcacctcactctcctca
gagcggagtcgatctgaggtagatttgagtgagtcatttgcggaagacttagaggacact
tcaagcataagaagcagatctgtccctggggctttagacaaagacttgaactccttagaa
gacactgaagacggtgttgacttagtgtcctccaggttttctgcaaatacccacagtctg
gcaagtggattgtcaactaactcccaagcaggatctgataggaagaggagctacctaaat
gtgcctgatgccgattcagacactactagccttaacagcatgatgagtgtttacagtgaa
acgggagactatggcaacgtgaaagtcaccggtgagatccttctccacatcagctactgc
tacaaaaccggcgggctatacatttttgtcaagagctgcagaaacctggccacaggagat
gaaaagaaacagaggacagatgcttatgtcaagtcataccttcttccagacaagtcccga
aacaacaagcgtaagaccaaaatcagaacgggtaccaatccagaattcaacgaaacatta
aagtataccatcagccacacccagctggaaacaagaactctgcagctctcagtctggcac
tatgatcggtttggacgcaacagtttcctgggagaggtggagattgcttttgactcatgg
aactttgaaaatccatgtgatgagtggtttgtgcttcagccgaaggtggagttggctcct
gatattagccttcaatacaaaggagagctaaccattgttttgcgttatattcctccagag
gagaacctaatattcccagcaggacagcgtcaagaaaagaagatctttaaaaggggaaag
aagaaagagtcatcttccatttctgggggaatacttgaagtgttcatcaaaaaagcaaag
aatctgacagcagtaaaatcaggaggcacttctgacagcttcgtcaagggctacctgctt
cctgatgataacaaagccaccaagcacaaaactgctgttgtaaaaaagagtgtcaatcct
gagtggaaccatacgttcatattcagtggcctgtatcctcaggatataaagaatgcttgc
ctagaactcaccatctgggacaaagaggccttttccagcaacgtctttctaggaggtgtt
cgtttaaattctggaagtggtatgagctacggtaaaactgtggactggatggactctcat
ggggaagagcaacgcctttggcaaaagatggctgacaaccctgggacatctgtagagggg
gttctcatgctacgttccagcatggcgaaatgtaggctctga

DBGET integrated database retrieval system