KEGG   Mus musculus (mouse): 236690
Entry
236690            CDS       T01002                                 

Symbol
Nyx, C, CLNP, CSN, CSNB1, CSNB4, n, nob
Name
(RefSeq) nyctalopin
  KO
K08129  nyctalopin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    236690 (Nyx)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class IV
    236690 (Nyx)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_1 LRR_9 LRRNT
Other DBs
NCBI-GeneID: 236690
NCBI-ProteinID: NP_775591
MGI: 2448607
Ensembl: ENSMUSG00000051228
Vega: OTTMUSG00000016909
UniProt: P83503
Position
X A1.1; X 8.37 cM
AA seq 476 aa
MLILLLHAVVFSLPYTRATEACLRACPAACTCSHVERGCSVRCDRAGLQRVPQEFPCEAA
SIDLDRNGLRILGERAFGTLPSLRRLSLRHNNLSFITPGAFKGLPRLAELRLAHNGELRY
LHVRTFAALGRLRRLDLAACRLFSVPERLLAELPALRELTAFDNLFRRVPGALRGLANLT
HAHFERSRIEAVASGSLLGMRRLRSLSLQANRVRAVHAGAFGDCGALEDLLLNDNLLATL
PAAAFRGLRRLRTLNLGGNALGSVARAWFSDLAELELLYLDRNSITFVEEGAFQNLSGLL
ALHLNGNRLTVLSWAAFQPGFFLGRLFLFRNPWRCDCQLEWLRDWMEGSGRVADVACASP
GSVAGQDLSQVVFERSSDGLCVDPDELNFTTSSPGPSPEPVATTVSRFSSLLSKLLAPRA
PVEEVANTTWELVNVSLNDSFRSHAVMVFCYKATFLFTSCVLLSLAQYVVVGLQRE
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgctgatcctgcttcttcatgcggtggtcttcagtctgccctacaccagggccaccgag
gcctgtctgcgggcctgccctgcggcctgcacctgcagccacgtggaacgtggctgctca
gtgcgctgtgaccgtgcgggcctccagcgggtgccccaggagtttccgtgcgaggcggcc
tccatcgatctggaccggaatggcctgcgcatcctgggcgagcgggcctttggcacgctg
ccgtcgttgcgccgcctgtcgctgcgccacaataacctgtccttcatcacgcccggcgcc
ttcaagggcctgccgcggttggccgagctgcgcctggcgcacaacggtgagctgcgctac
ctgcacgtgcggaccttcgcggcgctgggccgcctacgccgcctggacctggcggcctgc
cgcctcttcagcgtccccgagcgtctcctggccgagctgccggccctgcgcgagctcacg
gccttcgacaatctcttccgccgggtgcccggcgcgctccggggcctcgccaacctgacg
cacgctcatttcgagcgcagccgcatcgaggccgtggcctccggctcgctgctgggcatg
cggcgtctgcgctcgctcagcctgcaggccaaccgcgtgcgcgcggtgcatgccggggcc
tttggcgactgcggcgccctggaggacctgctgctcaacgacaacctgctggccacgctg
cccgccgccgccttccgcggccttcgccgcctgcgcaccctcaacctgggcggcaacgcg
ctgggcagcgtggcacgcgcctggttctcagacctggcagagctcgagctgctttacctg
gaccgcaacagcatcacctttgttgaggaaggcgccttccagaacctctcgggcctcctg
gccctgcatctcaatggcaaccgtctcactgtgctctcctgggccgctttccagccaggt
ttcttcctgggccgcctcttccttttccgcaatccttggcgctgtgactgccaactggag
tggctgcgtgattggatggagggctctgggcgtgtggctgatgtggcgtgcgcctcccca
ggctctgtggccggccaggacctcagccaggtggtctttgagcgctcctctgatggcctc
tgtgtggaccctgatgaactgaactttaccacgtccagtcctggcccgagtccggagcca
gtggccaccactgtgagcaggttcagcagcctcctctccaagctgctggccccaagggcc
cctgtggaggaggtagccaataccacctgggagctggtcaacgtctcgttgaatgacagc
tttcggtcccatgcagtgatggtcttctgctacaaggccacgtttctcttcacctcttgc
gtcttgctcagcctggcccagtatgtggtggtgggcctgcagagggagtga

DBGET integrated database retrieval system