KEGG   Mus musculus (mouse): 236733
Entry
236733            CDS       T01002                                 

Symbol
Usp11, 6230415D12Rik, mKIAA4085
Name
(RefSeq) ubiquitin specific peptidase 11
  KO
K11835  ubiquitin carboxyl-terminal hydrolase 4/11 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    236733 (Usp11)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    236733 (Usp11)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     236733 (Usp11)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   236733 (Usp11)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    236733 (Usp11)
SSDB
Motif
Pfam: UCH DUSP Ubiquitin_3 UCH_1 USP7_C2 DNA_pol_phi
Other DBs
NCBI-GeneID: 236733
NCBI-ProteinID: NP_663603
MGI: 2384312
Ensembl: ENSMUSG00000031066
Vega: OTTMUSG00000017158
UniProt: Q99K46 Q3TFK2 Q8BX45 Q8C0C2
Position
X:20570148..20586778
AA seq 921 aa
MAAVAADPAAAAVPASAEDRDTQPEAMPDLDEQWRQIGNGRERPLRAGESWFLVEKHWYK
QWEVYVKGGDQDASTFPGCINNAGLFEDQISWHLRERLLEGDDYVLLPAPAWNYMVSWYG
LMDGQPPIERKVIELPGIRKVEVYPLELLLVQHSDMETALTIQFSYTDSVELVLQTAREQ
FLVEPQEDTRLWTKNSEGSLDRLCNTQITLLDACLETGQLVIMETRNKDGTWPSAQLCGM
NNIPDEDEDFQGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNRYLEELNFRNPL
GMKGELAEAYADLVKQTWSGYHRSIVPNVFKNKVGHFASQFLGYQQHDSQELLSFLLDGL
HEDLNRVKKKEYVELCNGAGRPDLEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCG
NVSVTFDPFCYLSVPLPVCSRRVLEVFFVPMDPRRKPEQHRVVVPKKGNISDLCVALSTH
TSVAPDKMIVADVFSHRFYKLYQLEDPLSGILDRDDIFVYEVTGRIEPVEGSRDDIVVPV
YLRERTPSRDYNNSYYGLILFGHPLLVSVPRDRFSWEGLYNILMYRLSRYVTKPTSDEDD
GDEKVDEDEDEDVEDDSSSEEEKEEMSAPTVNDGTREAEQEQAGTSSGVTERCPSLLDNS
LRASQWPPRRRRKQLFTLQTVNSNGTSDRTTSPEEMQTQPYIAMDWEPDMKRRYYDEVEA
EGYVKHDCVGYMLKKSPVQLKECIKLFTTVETLEKENPWYCSSCKQHQLATKKLDLWMLP
EVLIIHLKRFSFSKISREKLDTLVQFPIRDLDFSEFVIKPKNESSPDLYKYDLIAVSNHY
GGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDVGRRQSQTSS
SDTPASPVSSSTPNSDIMDIN
NT seq 2766 nt   +upstreamnt  +downstreamnt
atggcggcggtcgcagcggacccagctgcagctgccgtcccggcctctgctgaggaccga
gacacacagcccgaggcaatgccagacctggatgaacagtggcgccaaatcgggaatggg
cgagagcgtccactgcgagctggcgaaagctggttccttgtggagaaacactggtataaa
cagtgggaggtgtacgtgaagggaggggatcaagatgctagcacctttcctggctgtatc
aacaatgctgggctctttgaagatcagataagctggcatctcagggagagactgctagaa
ggagatgattatgtgctgctcccagcgcctgcttggaactacatggtcagctggtatggc
ttaatggatggccagccacctattgagcgcaaggtaatagaacttcctggcattcggaag
gtggaagtgtacccactagagctactgctcgttcagcacagtgatatggaaacagctctc
accattcagtttagctatactgattctgtggaactagtcttgcaaacagctcgggagcag
tttctggtagagcctcaggaagacacgcgcctctggaccaagaactcagagggctctttg
gatcgactgtgtaatacacagatcacgctgcttgatgcctgccttgagactgggcagttg
gtcatcatggagactcgaaacaaagatggcacttggcccagtgctcagctgtgtggcatg
aacaacataccggacgaggatgaggacttccaggggcaaccgggcatctgtggccttacc
aatctgggcaacacatgcttcatgaactcggccctacagtgcctgagcaatgtgccacag
ctgacagagtactttctcaacaatcgctacctagaggagctcaacttccggaaccctcta
ggcatgaagggtgagcttgctgaggcctatgcagatctggtaaagcagacttggtctggc
taccaccgctccattgtgccaaatgtgttcaagaacaaggttggccattttgcatcccag
tttctgggctaccagcagcatgactcacaggaactactgtcattcctcctggatgggcta
catgaggatctcaatcgggtcaaaaagaaagaatatgttgagctatgcaatggtgctggg
cggcctgatctggaagtggctcaggaagcctggcagaaccataaacgacgaaatgattct
gtgatcgtggacactttccatggcctcttcaagtccaccctggtgtgccctgattgtggc
aatgtttctgtgacctttgaccccttctgctacctcagtgtcccactgcctgtctgctcc
aggagggtcttggaagtcttctttgtccccatggatccccgccgcaagccagaacagcac
cgggttgtagtccccaagaagggcaatatctcagatctgtgtgtggctctgtccacgcat
acaagtgttgcaccagacaagatgatagtagctgatgtcttcagtcaccgattctataag
ctttaccagctggaggatcctctgagtggcatcttggatcgtgatgatatctttgtatat
gaggtgactggtcggattgagccggttgagggttcaagagatgatattgtggtacctgtt
tacttgcgggagcgcaccccatccagagactacaacaactcctactatggtctgatactt
tttgggcaccctctcctggtgtcagtgccccgggaccggttctcctgggagggcctatat
aacatcttgatgtaccgactttcacgatatgtgaccaaacccacctcagatgaggatgat
ggggatgagaaagttgatgaagatgaggatgaggatgtggaagatgacagcagcagtgag
gaggaaaaggaggaaatgtctgcgcccactgttaatgatgggacccgagaagcagagcag
gagcaggctgggaccagctctggggtcactgagagatgcccatccctcttagacaacagc
ctccgcgcatcgcagtggcccccaaggcgacgacgaaagcagctgtttactctgcagacg
gtgaactccaatggaaccagtgaccggaccacttcccctgaagaaatgcaaacccagcca
tacattgccatggattgggaaccagatatgaagaggcgttattatgacgaagtggaggct
gagggctatgtgaagcatgactgtgtgggctacatgctgaagaaaagtccagtgcagctg
aaggagtgcatcaaactcttcaccactgtggaaaccctggagaaggagaacccctggtac
tgctcctcctgcaagcagcaccagctggccaccaagaaactggacctctggatgctaccc
gaagttctcattatccacctgaagcgtttttcattttccaaaatttcccgggagaagctg
gacaccctggtgcagtttcctatccgggacctggatttctctgagtttgtcatcaaacca
aagaatgagtcttctccagacctctacaaatatgatctcatcgcagtttccaaccattat
ggtggcatgcgtgatggacactatacaacatttgcctgcaacaaggacagtggccagtgg
cactactttgatgacaatagtgtctcacctgtgaatgagaatcagattgagtccaaggca
gcctatgtcttgttctatcagcgccaagatgtgggtcgacgccagtcccagacttcttca
tctgacactcctgcctctcctgtctccagttctacacccaactctgacatcatggatatc
aactaa

DBGET integrated database retrieval system