KEGG   Mus musculus (mouse): 236781Help
Entry
236781            CDS       T01002                                 

Gene name
Gpr119
Definition
(RefSeq) G-protein coupled receptor 119
  KO
K08424  glucose-dependent insulinotropic receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    236781 (Gpr119)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    236781 (Gpr119)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    236781 (Gpr119)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Oleoylethanolamide
    236781 (Gpr119)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 236781
NCBI-ProteinID: NP_861416
MGI: 2668412
Ensembl: ENSMUSG00000051209
Vega: OTTMUSG00000017712
UniProt: Q7TQP3
Position
X; X A5
AA seq 335 aa AA seqDB search
MESSFSFGVILAVLTILIIAVNALVVVAMLLSIYKNDGVGLCFTLNLAVADTLIGVAISG
LVTDQLSSSAQHTQKTLCSLRMAFVTSSAAASVLTVMLIAFDRYLAIKQPLRYFQIMNGL
VAGACIAGLWLVSYLIGFLPLGVSIFQQTTYHGPCSFFAVFHPRFVLTLSCAGFFPAVLL
FVFFYCDMLKIASVHSQQIRKMEHAGAMAGAYRPPRSVNDFKAVRTIAVLIGSFTLSWSP
FLITSIVQVACHKCCLYQVLEKYLWLLGVGNSLLNPLIYAYWQREVRQQLYHMALGVKKF
FTSILLLLPARNRGPERTRESAYHIVTISHPELDG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggagtcatccttctcatttggagtgatccttgctgtcctaaccatcctcatcattgct
gttaatgcactggtagttgtggctatgctgctatcaatctacaagaatgatggtgttggc
ctttgcttcaccttgaatctggccgtggctgataccttgattggcgtggctatttctggt
ctagttacagaccagctctccagctctgctcagcatacacagaagaccttgtgtagcctt
cggatggcatttgtcacttcttctgcagctgcctctgtcctcaccgtcatgctgattgcc
tttgacagataccttgccattaagcagcccctccgttacttccagatcatgaatgggctt
gtggctggagcatgcattgcaggactgtggttggtatcttaccttatcggcttcctccca
ctcggagtctccatattccagcagaccacctaccatggaccctgcagcttctttgctgtg
tttcacccaaggtttgtgctgaccctctcctgtgctggcttcttcccagctgtgctcctc
tttgtcttcttctactgtgacatgctcaagattgcctctgtgcacagccagcagatccgg
aagatggaacatgcaggagccatggccggagcttatcggcccccacggtctgtcaatgac
ttcaaggctgttcgtactatagctgttcttattgggagcttcactctgtcctggtctccc
tttctcataactagcattgtgcaggtggcctgccacaaatgctgcctttaccaagtgctg
gaaaagtacctgtggctccttggagttggcaactccctactcaacccactcatctatgcc
tattggcagagggaggttcggcagcagctctaccacatggccctgggagtgaaaaagttc
ttcacttcaatcctcctccttctcccagccaggaatcgtggtccagagaggaccagagaa
agcgcctatcacatcgtcactatcagccatccggagctcgatggctaa

DBGET integrated database retrieval system