KEGG   Mus musculus (house mouse): 236900
Entry
236900            CDS       T01002                                 
Symbol
Pdk3, 2610001M10Rik, AI035637
Name
(RefSeq) pyruvate dehydrogenase kinase, isoenzyme 3
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    236900 (Pdk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    236900 (Pdk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     236900 (Pdk3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   236900 (Pdk3)
SSDB
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 236900
NCBI-ProteinID: NP_663605
MGI: 2384308
Ensembl: ENSMUSG00000035232
Vega: OTTMUSG00000017968
UniProt: Q922H2 Q4FJR4
Position
X:complement(92798923..92875756)
AA seq 415 aa
MRLFYRLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANT
MREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPRVLDNFLNVLINIRNRHN
DVVPTMAQGVIEYKEKFGFDPFISSNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPAH
PKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPNKPIQVVYVPSH
LFHMLFELFKNSMRATVELHEDKKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRL
FNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKA
LSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAKQDKIKSNRTF
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgcggctcttctaccggctgctcaagcagccggtccccaagcagatcgagcgctactcc
cgcttctccccgtcgccactgtctatcaaacagttcctggacttcggaagggataatgca
tgtgaaaaaacttcctatatgtttctgcgcaaggaacttcctgtgcgactggctaacacc
atgagagaggttaatctcttgccggataacttgttgaaccgcccttccgtgggattagtt
cagagctggtacatgcagagcttccttgaacttttagaatatgaaaacaagagcccagaa
gacccacgagttttggataactttctcaacgttctgataaatatcagaaacagacacaat
gatgttgttcctacaatggcccaaggcgtgattgagtacaaggaaaagttcgggtttgat
ccgttcattagcagtaacattcaatatttcctggatcggttttataccaaccgcatttct
ttccgcatgcttattaaccagcacacacttctgtttggtggtgacactaaccctgcacat
ccgaaacatatagggagtatcgaccccacctgtaatgtagctgatgtggttaaagatgca
tatgaaacagccaagatgctttgtgaacagtattacctggtagctccagagctagaagtt
gaagaattcaatgccaaagcgccaaacaaacccattcaggtagtttatgtgccgtcacat
ctgtttcacatgctatttgagctgttcaagaactcaatgagggcaacagttgaactacat
gaagataaaaaagaaggctacccagctgttaaaactctcgttactctgggtaaagaagac
ttgtccattaagataagtgacctaggtggtggagtcccacttcgaaaaatagaccgtctt
tttaactacatgtactcaactgctcctcgtcccagcctggagcctacaagagcggcgccc
ttggctggatttggttatggcttgccaatttctcgtctgtatgccagatattttcaggga
gatctaaaactgtattccatggaaggagtgggtaccgatgcagtcatttatttgaaggcc
ctttcaagtgaatcctttgagaggctgccagttttcaataagtctgcatggcgccattac
aagaccactcctgaagctgatgactggagcaatcccagcagtgaaccaagggatgcatca
aaatacaaggctaaacaggacaagatcaagagtaatagaactttctag

DBGET integrated database retrieval system