KEGG   Mus musculus (mouse): 237082
Entry
237082            CDS       T01002                                 

Symbol
Nxt2, 6330587F24Rik, AI787442, P15-, P15-2
Name
(RefSeq) nuclear transport factor 2-like export factor 2
  KO
K14285  NTF2-related export protein 1/2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
mmu03013  Nucleocytoplasmic transport
mmu03015  mRNA surveillance pathway
mmu05014  Amyotrophic lateral sclerosis
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    237082 (Nxt2)
   03015 mRNA surveillance pathway
    237082 (Nxt2)
   03008 Ribosome biogenesis in eukaryotes
    237082 (Nxt2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    237082 (Nxt2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    237082 (Nxt2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    237082 (Nxt2)
   03009 Ribosome biogenesis [BR:mmu03009]
    237082 (Nxt2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     237082 (Nxt2)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    237082 (Nxt2)
SSDB
Motif
Pfam: NTF2 QRPTase_N
Other DBs
NCBI-GeneID: 237082
NCBI-ProteinID: NP_001154902
MGI: 2147914
Ensembl: ENSMUSG00000042271
Vega: OTTMUSG00000018737
UniProt: Q3UNA4
Position
X; X F2
AA seq 142 aa
MALAVNFKTYVDQACRAAEEFVNIYYETMDKRRHALVRLYLDKATLIWNGNVVTGLEALA
NFFEMLPSSEFQINMLDCQPVHEQATQCQTTVLVVTSGVVKFDGNKQHFFNQNFLLTAQS
TPNSTVWKIASDCFRFQDWASI
NT seq 429 nt   +upstreamnt  +downstreamnt
atggccttggcagtgaattttaaaacttatgtggatcaggcatgtagagctgccgaggaa
tttgtcaatatttactatgagacaatggacaaaagacgacatgcacttgtcaggctgtat
ttggacaaagccactctaatctggaatggaaatgttgttacagggctggaagcccttgct
aatttttttgagatgttgccttccagcgaattccagatcaatatgttagattgccaacca
gttcatgagcaagctacccagtgccaaactacagtgctcgttgtgaccagtggagttgtg
aagtttgatggaaacaagcagcacttctttaaccagaacttcctgctgactgcgcagagc
actcctaacagcactgtgtggaagattgcaagtgattgcttccgttttcaagattgggct
agtatttaa

DBGET integrated database retrieval system