KEGG   Mus musculus (mouse): 237221
Entry
237221            CDS       T01002                                 

Gene name
Gemin8, B130034M20Rik, B930082C09Rik, BC023488, gemin-8
Definition
(RefSeq) gem nuclear organelle associated protein 8
  KO
K13136  gem associated protein 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    237221 (Gemin8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    237221 (Gemin8)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    237221 (Gemin8)
SSDB
Motif
Pfam: GEMIN8
Other DBs
NCBI-GeneID: 237221
NCBI-ProteinID: NP_001297651
MGI: 2384300
Ensembl: ENSMUSG00000040621
Vega: OTTMUSG00000019540
UniProt: Q8BHE1
Position
X; X F5
AA seq 238 aa
MASNWRASASWYSHPVYARYWQHYHHAMLWMQGHQNAYRKFRDSYFTSPWLFPHGALPWN
SPAYEAGHPWDSQGQHMAQQESPYRVSHPKSPGQPLRNSSRTQASTRGNEARCEEEELES
DSDDEVECDLSNMEITEELRQYFAQTERHREERRRQQQLDAERLNDYVNADHGLYFNHRR
SLEPPSEKPWERRQAEMKRLYGNSAPKILAMETAVQLSFDKHCDRKQPKYWPVIPLKF
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcctccaactggagggctagtgcatcttggtattctcacccagtatatgcaagatac
tggcaacattatcatcacgcaatgctttggatgcagggccaccagaatgcctacagaaag
ttcagggattcctatttcacatccccgtggctcttccctcatggagctcttccctggaac
tctcctgcttatgaggctgggcatccttgggactctcaaggccagcacatggcgcagcag
gagtctccctaccgtgtttcccatcccaaaagccctgggcagcctctgcgtaatagcagt
agaacccaggcatccacaagagggaatgaagcacggtgtgaggaggaagagctggagtca
gattcagatgatgaagtagagtgcgacctgagcaatatggagatcaccgaggagctccgg
cagtacttcgcgcagaccgagaggcacagagaggagagaaggcgacagcagcagctggac
gcagagcgcctgaatgactatgtgaatgcggaccatggcctgtacttcaaccaccgtagg
tcactggaacccccatctgagaagccctgggagcggcgccaagcagagatgaagcgctta
tatggcaacagtgctcccaagatcctggccatggagactgctgtacagctgagctttgac
aagcactgtgacagaaagcaaccaaagtactggcctgtcattcccctgaagttctga

DBGET integrated database retrieval system