KEGG   Mus musculus (mouse): 237222
Entry
237222            CDS       T01002                                 

Symbol
Ofd1, Cxorf5, DXGgc7e, ORF2
Name
(RefSeq) OFD1, centriole and centriolar satellite protein
  KO
K16480  oral-facial-digital syndrome 1 protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    237222 (Ofd1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    237222 (Ofd1)
   Pericentriolar materials (PCM)
    Centriolar satellite
     237222 (Ofd1)
   Centrosome duplication proteins
    Centriole replication proteins
     237222 (Ofd1)
SSDB
Motif
Pfam: LisH_2 LisH
Other DBs
NCBI-GeneID: 237222
NCBI-ProteinID: NP_803178
MGI: 1350328
Ensembl: ENSMUSG00000040586
Vega: OTTMUSG00000019549
UniProt: Q80Z25 Q3URP3 A2AEG2
Position
X F5; X 77.28 cM
AA seq 1019 aa
MRMAQSNMPHKSDVLSQDELRKKLYQTFKDRGVLDTLQTQLRNQLIHELMHPVLSGEVKP
PSISVEGSALLIGASNSLVADHLQRCGYEYSLSVFFPESGLAKEKIFTMQDLLQLIRINP
SSSLYKSLISGFDKENKKGFLMSFLKELAEYYQAKESCDAETQTSTTFPSQVSLAEKFQL
IDAQFADGFPHRSKLESLETKLNEYKKEVQHQLQVEMCHKLKYFREAEITKVKMEERRKY
EKELAEFQNEFERTCQAKNEALISQEKNSLERIKKHREMESKEIYAQRQLLLNDIALLRG
REAELKERIETFELTQKLQEEKIKSEAEALERREQNLKNIEDTYDQKLKTELLKYQLELK
DDYITRTNKLLEEERKNKEKTIHLQEELTVINSKKEELSKSVKHMKEVELELESVKAQFL
AISKQNHLLNEKVREMSDYSQLKEEKVELQAQNKLLKLQLEETRNENLRLLDRITQPPPE
LVIFQKELQKTEKAMELEHKDFETHRQALEKQLQSEIENSAQLRTQIAEYDASVKRLTVQ
VAELKSQLKQTQIALENEVYRNPKHSLIHSLSGLLLSGKMAPHSEDKSGDFLNVPLEQNK
VIAGAVMSRVPPYVNTATEASSPESDFEFIASSTKAKVRELEQEAERLEKAFRTYYQRAT
QNPSTSPQPAKSPPSVNSVAALRSIASSSMDRPVSAEDRVVSEQPLGDMLKEEMSDMSKA
FMGSVVSRPRRTSSSTRLSSTPHPKSRRSLDNEMYLEGLGRLHMTSSSPLLDRVSASPAA
SPSPCPERTAQASPVPSRHSFSGLPEQNACLYQRQTETQDKSELSNVDKQSLKDEKFEPP
FRWNKTEQFEAEGLHPAGDMPGIDFAVATQSSRLISYDYPSAVQSQTGEQDEQELWELHM
KERRQREEQRHNERQEALERERRELGKLEQERRMIEESLKMEMEEELEKSVQDQKDKSAH
CENTLEKYMKIIQQRQEESNADKSSKKSGKECSLVDMMMPSDKDESSPGFSHEEPDDMW
NT seq 3060 nt   +upstreamnt  +downstreamnt
atgaggatggctcagtccaacatgccccacaagtctgatgtgttgagtcaagatgaactg
cgcaaaaagctataccagacgtttaaggatcggggtgtactggacacacttcagacccaa
ctccgaaaccagctaattcatgaattgatgcatcctgtattgagtggagaagtgaagccg
ccatccatttcagtggaagggagtgccctcctaataggggcttctaactcgctggtggca
gaccacttacaaagatgtggctatgaatattcactctctgttttctttccagaaagtggt
ttggcaaaagaaaagatatttactatgcaggatctactacaactcattcggattaacccc
tcatccagtctctataaatcattgatttcaggatttgataaagaaaataaaaaaggtttt
cttatgagtttcttaaaggagttggcagaatattatcaagctaaagagagctgtgatgcg
gaaactcagacaagcaccacatttcccagccaagtgtccctagccgagaagtttcagctt
attgacgctcaatttgcagatggttttcctcaccgttccaagctagaatctttagagaca
aagttaaacgagtataagaaagaagtacaacaccagcttcaggtagaaatgtgtcataag
ctgaagtattttagagaagctgaaataacaaaagttaagatggaagagagaagaaagtat
gaaaaggaattggctgagttccagaatgaatttgaaagaacttgtcaagcaaaaaatgaa
gccctcatttctcaggagaagaattctctggaaagaattaaaaaacaccgagagatggaa
tcaaaagaaatttatgctcaaagacagcttctactaaatgatatagctttgcttagaggt
agagaagcagagctgaaggagcgaatcgaaacttttgaattgacccagaagctccaagaa
gaaaaaattaaaagtgaggctgaggcacttgagagacgggaacagaatctgaagaatatt
gaagacacctatgatcagaaactcaaaactgaactgctaaagtaccaactggagctaaag
gatgactacatcactaggacaaataaactcctggaagaggaaaggaagaataaagaaaaa
actattcatttgcaagaggagctcacagttattaattcaaaaaaggaagaactcagtaaa
tctgttaagcatatgaaagaagttgagctggaactggagtctgtgaaagctcagttttta
gcaatatcaaaacaaaaccacttgctgaatgaaaaggtgagagagatgagtgattactca
caactgaaagaagagaaagtggagcttcaggcacaaaataaactacttaaactgcaactg
gaagagactaggaatgaaaacttacgactcctagaccgcataactcagccacctcctgag
cttgtgatttttcagaaggaattacagaaaacagaaaaggctatggaactggagcacaag
gactttgaaactcataggcaggctcttgagaaacagctgcagagtgaaattgaaaattct
gcacagctaaggacccagatagcagaatatgatgcttctgtcaaaaggttaactgttcag
gtggctgagttaaagtcacaactaaaacaaactcagatagccctagagaatgaagtgtac
cgaaatccaaaacactctctgattcattccctgagtggcctcctattgagcggcaagatg
gcaccccacagtgaagataaaagtggggatttcttgaatgtaccccttgaacagaacaag
gttatagcaggtgcagttatgtcaagggtcccaccttatgtaaatacagcaacagaagct
agttccccagagtctgactttgagtttatagccagtagtactaaagccaaagtaagagag
ctagagcaagaggctgaacgcttggaaaaggcattcagaacttactatcaaagagctact
cagaatccttctacgagccctcagccggcaaagagtcctccatctgtaaactcggtggca
gctctcagaagcatagcttccagttccatggacagacctgtttctgcagaggacagagtt
gtctcggaacagcctcttggggacatgctgaaggaagaaatgagtgatatgtccaaagca
ttcatgggcagtgtggtttcacggccacgcaggacctcttcctccacacgcctctcctct
acaccccatccaaaatcgagaagaagtcttgataatgaaatgtatctggaaggtctcggg
agattacacatgacttcctccagccctcttcttgacagagtttctgcatcacctgctgct
tcccctagtccttgtcctgagagaacagcccaggcgtcacctgttccatctaggcacagc
ttctctggtcttccagagcaaaatgcctgtttatatcagagacaaactgaaacgcaagat
aaaagtgagctttcaaatgtggacaagcaatctttgaaagatgagaaatttgaaccacct
ttcagatggaacaagacagaacagtttgaagcagaaggactccaccctgctggtgacatg
cctggaatagattttgctgtggctactcagtcttcaagactcatttcatacgactaccca
agtgctgttcagagccaaactggagaacaagacgaacaggagctatgggagcttcacatg
aaagaacgcaggcagagagaagaacaaaggcataatgaacggcaagaagctttagagagg
gaaagaagagagctgggaaaactagagcaggagcggaggatgattgaagagtcactgaag
atggagatggaagaagaattagaaaagagtgttcaagaccagaaagacaaatcagctcat
tgtgaaaatactttagaaaaatacatgaaaattatccagcagagacaggaagaatcaaat
gcagataagagctccaaaaaatcgggcaaagaatgctcactagtggacatgatgatgcct
agtgacaaggatgaaagttctccaggattttctcatgaagaaccagatgacatgtggtaa

DBGET integrated database retrieval system