KEGG   Mus musculus (mouse): 237313Help
Entry
237313            CDS       T01002                                 

Gene name
Il20ra, E230031K19
Definition
(RefSeq) interleukin 20 receptor, alpha
  KO
K05136  interleukin 20 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    237313 (Il20ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    237313 (Il20ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    237313 (Il20ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    237313 (Il20ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL10/28 receptor family
   237313 (Il20ra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tissue_fac Interfer-bind fn3
Motif
Other DBs
NCBI-GeneID: 237313
NCBI-ProteinID: NP_766374
MGI: 3605069
Ensembl: ENSMUSG00000020007
Vega: OTTMUSG00000063784
UniProt: Q6PHB0
Position
10; 10 A3
AA seq 546 aa AA seqDB search
MHTPGTPAPGHPDPPPLLLLTLLLLLAASGRAVPCVFCGLPKPTNITFLSINMKNVLHWN
PPESLHGVEVTYTVQYFIYGQKKWLNASKCGSINRTYCDLSVETSDYEHQFYAKVKAIWE
ARCSEWAETERFYPFLETQVSPPEVALTTGEKSISIALTAPEKWKRNPQDHTVSMQQIYP
NLKYNVSVYNTKSRRTWSQCVTNSTLVLSWLEPNTLYCVHVESLVPGPPRLPMPSQKQCI
STLEVQTSAWKAKVIFWYVFLTSVIVFLFSAIGYLVYRYIHVGKEKHPANLVLIYRNEIG
TRVFEPTETITLNFITFSMLDDTKISPKDMNLLDKSSDDISVNDPEHNEAWEPHWEEVEG
QHLGCSSHLMDAVCGAEQRDGDTSLTQHGWLNSTIPTGETDTEPQYKVLSDFYGEGEIQL
SCEPEEAARTEKISEPLVTSANLDPQLEDLHHLGQEHTVSEDGPEEETSITVVDWDPQTG
RLCIPSLPIFGRDPENYGHYERDQLLEGGLLSRLYENQAPDKPEKENENCLTRFMEEWGL
HVQMES
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcacactcccgggaccccggcgccgggccacccggacccgccgccactgttgctgctc
acgctgcttctgctgctggccgcttcgggacgcgcagttccttgtgtcttctgtggtttg
cctaaacctacaaatatcaccttcttatccatcaacatgaagaatgtcctgcattggaat
ccaccagagagtctacacggagttgaagtcacatacactgtgcaatatttcatatatggg
cagaagaaatggctgaatgcctctaaatgcgggagtatcaacaggacctactgtgacctt
tctgttgagacctcagactatgaacaccagttctatgccaaagtgaaggccatttgggaa
gccaggtgctccgaatgggccgagacggaacgcttctatcctttcttggaaactcaagtc
agcccaccagaggttgccctgacaactggcgagaagtccatctctattgccctgacagca
ccagagaagtggaaaagaaatccacaagaccacactgtttctatgcaacagatatacccc
aatttgaagtacaatgtgtctgtgtataacactaagtcgagaagaacgtggtcccagtgt
gtcaccaacagcacactggtcctcagctggctggagcccaacactctgtattgtgtccac
gtggagtcccttgtcccagggccccctcgcctcccgatgccttctcagaagcagtgcatc
agtactttggaagttcaaacatcagcatggaaggctaaagtcatcttctggtatgtcttc
ctcacatctgttatcgtgtttcttttctccgcaattggctacttggtttaccgttacatc
catgttggcaaggaaaaacacccagcaaatttggtactgatttatagaaatgaaattggc
acaagagtctttgaacctactgaaacaatcacacttaattttatcaccttcagtatgttg
gatgatactaaaatttctccaaaggatatgaatttactggacaaaagcagtgatgacatc
agtgttaatgaccctgagcacaatgaggcctgggagccgcactgggaggaggtggagggg
caacatttaggatgctcttcgcatttgatggacgctgtctgtggtgctgagcaaagagac
ggagacacctccctaacccagcatgggtggcttaacagcaccatccccacaggagagaca
gacactgagcctcaatacaaagtcctaagtgacttctacggggagggtgaaatccaactg
tcctgtgagccggaagaggcggccagaacagagaaaatatctgagccactggtgacttca
gcaaacttggacccacagcttgaagacctacatcacctgggtcaggagcatactgtctcc
gaggatgggccagaggaagagacatctataacagtagtggattgggaccctcaaactggc
aggctgtgtatcccttccttacctatctttggccgtgatcctgagaactatggtcattat
gagagagaccagctcttagagggtggccttttgtctagactctatgagaaccaggcacct
gacaagccagagaaagaaaatgaaaactgtctcacacggtttatggaggaatgggggtta
catgtacaaatggaaagctag

DBGET integrated database retrieval system