KEGG   Mus musculus (mouse): 237320Help
Entry
237320            CDS       T01002                                 

Gene name
Aldh8a1, Raldh4
Definition
(RefSeq) aldehyde dehydrogenase 8 family, member A1
  KO
K23234  aminomuconate-semialdehyde dehydrogenase [EC:1.2.1.32]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00380  Tryptophan metabolism
mmu01100  Metabolic pathways
Module
mmu_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    237320 (Aldh8a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.32  aminomuconate-semialdehyde dehydrogenase
     237320 (Aldh8a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 237320
NCBI-ProteinID: NP_848828
MGI: 2653900
Ensembl: ENSMUSG00000037542
Vega: OTTMUSG00000028021
UniProt: Q8BH00
Position
10; 10 A3
AA seq 487 aa AA seqDB search
MAGKRELLMLENFIGGKFLPCNSYIDSYDPSTGEVYCKVPNSGKEEIEAAVEAAREAFPA
WSSRSPQERSLVLNRLADVLEQSLEELAQAESKDQGKTLTLARTMDIPRSVLNFRFFASS
NLHHVSECTQMSHLGCMHYTVRTPVGIAGLISPWNLPLYLLTWKIAPAIAAGNTVIAKPS
EMTSVTAWMFCKLLDKAGVPPGVINIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLEECIPATVRSSFANQGEICLCTSRIFVQRSIY
SEFLKRFVEATRKWKVGVPSDPSANMGALISKAHLEKVRSYVLKAQTEGARILCGEGVDQ
LSLPLRNQAGYFMLPTVITDIKDESRCMTEEIFGPVTCVVPFDSEEEVITRANSVRYGLA
ATVWSKDVGRIHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEI
KTITIKY
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaaaagggaacttttgatgttggagaactttataggtgggaagtttttaccc
tgtaactcatatatagattcttacgatccatcaacaggggaagtttattgcaaagttcca
aacagtgggaaagaagagattgaagctgccgtggaggctgccagagaggccttccctgcc
tggtcatcccggagtccccaggaacgttctctcgtcctgaacaggctggctgatgtactg
gagcagtctctggaggagttagctcaggcagaatctaaagaccaagggaaaaccctcacg
ctggcaaggaccatggacattcctcggtctgttctgaacttccggttcttcgcttcctcc
aacctgcaccacgtatcggagtgcacacagatgagccacctgggctgtatgcattacacc
gttcgcaccccggtgggaattgctggtttgatcagcccttggaatttaccactctacctg
ctgacctggaagatagctccggccatcgctgctgggaataccgtgatagccaagcccagt
gagatgacttctgtgactgcctggatgttttgtaaactcttggataaagcaggtgtccca
ccaggtgtgatcaacattgtgtttggaacagggccgagggttggtgaagcccttgtgtct
caccccgaggtacccttgatctcgttcactgggagccagcccacagctgaacggattacc
cagctcagtgccccccactgcaagaagctttccctggagctgggaggcaagaatcctgct
atcatctttgaggatgccaacctggaggagtgtatcccggcaaccgttaggtccagcttt
gctaaccagggggagatttgcctttgtaccagtagaatctttgtccagagaagcatctac
agtgaatttctgaagaggtttgtggaagctaccagaaagtggaaagttggtgttccttct
gacccatcagccaacatgggtgctctgataagcaaagcacatttggagaaagtcagaagt
tatgtcttgaaagctcagactgagggtgcccggattctctgtggtgagggtgtggaccag
ctgagccttccactcaggaaccaggcaggctacttcatgcttcccacggtgataacagac
attaaggatgagtcccgctgcatgacggaagagatctttggtccagtgacgtgtgttgtt
ccgtttgatagtgaagaggaagtgattacgagagctaacagtgttagatacgggctggca
gccacagtgtggtccaaggatgtggggcgcatccacagggtagctaagaagcttcagtcg
gggctggtctggaccaactgctggctcatcagggagctgaacctgccctttggagggatg
aagagctctggaataggaagagaaggagccaaggactcatatgacttctttactgaaata
aaaaccattaccattaaatactga

DBGET integrated database retrieval system