KEGG   Mus musculus (mouse): 237339
Entry
237339            CDS       T01002                                 

Gene name
L3mbtl3, AI481284, MBT-1
Definition
(RefSeq) L3MBTL3 histone methyl-lysine binding protein
  KO
K24387  lethal(3)malignant brain tumor-like protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    237339 (L3mbtl3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2HisCys zinc factors
    237339 (L3mbtl3)
Motif
Pfam: MBT SAM_1 SAM_2 zf-C2HC Presenilin Glyco_hydro_2_N SOG2
Other DBs
NCBI-GeneID: 237339
NCBI-ProteinID: NP_766375
MGI: 2143628
Ensembl: ENSMUSG00000039089
Vega: OTTMUSG00000037127
UniProt: Q8BLB7
Position
10; 10 A4
AA seq 883 aa
MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDESEMESVKKATA
TTTWMVPTAQDAPTSPPSSRPVFPPAYWTSPPGCPTVFSEKTGVPFRLKEQSKADGLQFC
ENCCQYGNGDECLSGGKYCSQNCARHAKDKDQKDERDGGEDNDEEDPKCSRKKKPKLSLK
ADSKDDGEERDDEMENKQDGRILRGSQRARRKRRGDSAVLKQGLPPKGKKTWCWASYLEE
EKAVAVPTKLFKEHQSFPYNKNGFKVGMKLEGVDPDHQAMYCVLTVAEVCGYRIKLHFDG
YSDCYDFWVNADALDIHPVGWCEKTGHKLRPPKGYKEEEFNWQSYLKTCKAQAAPKSLFE
NQNITVIPSGFRVGMKLEAADKKSPSVICVATVTDMVDNRFLVHFDNWDESYDYWCESNS
PHIHPVGWCKEHRRTLITPPGYSHVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMK
LEAVDKRNPLFIRVATVADTDDHRIKVHFDGWSSCYDYWIDADSPDIHPVGWCSKTGHPL
QAPLSPAELMEPSETGGCPTLGCRGVGHFKKSRYLGTQSGANCPYSEINLSKERIFPDRL
SGDTSPPTTPSFPRSKRMDTRESSSSPETREKHANNFKEDSEKKKENEVKTSAEAKVVRE
EPTPSVQQSQPPQQVQQVQHAQPPQQAQKAPQAQQAQQAQQAQQAPQAPQTPQPQQAPQV
QQAQQAPQAQQAQQPQQAQQPQQAPPVQQPQQVQQAQPTQQQAQTQQQAQRRSAVFLSFK
PPIPCLPLRWEQQSKLLPTVAGIPASRVSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDG
EAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNSHNEL
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgactgaatctgcatctagcacaagtggtcaagagtttgatgtgtttagtgttatggac
tggaaggatggcgttggtaccctaccagggagtgatttaaagtttcgagtaaatgagttt
ggagctttggaagttatcacagacgaaagcgagatggaaagtgttaagaaagctacagcc
actaccacatggatggtcccaactgctcaagacgccccgacttctcccccgagctccagg
cccgtatttccacctgcctactggacatctccacctggatgtcccacagtcttttcagag
aagactggggtacccttcaggctgaaggagcaatcaaaagcagacgggcttcagttttgt
gagaactgttgtcagtatggcaacggagatgaatgtctttcgggaggaaagtattgcagc
cagaattgtgctcggcatgccaaagacaaagatcaaaaggatgaacgggatggaggcgaa
gacaacgatgaggaagatcctaagtgtagtcgaaagaaaaagccaaaattgtctctgaag
gcggactccaaggacgatggagaagagagagatgatgaaatggagaacaaacaagatgga
aggatcctgaggggttctcagagagccagaaggaaaagacgcggggattctgccgtctta
aagcaaggcttgcctcctaaaggcaagaagacctggtgttgggcttcctacctggaggag
gagaaagcagtggctgtgcctacgaagctgttcaaagagcaccaatccttcccatataac
aaaaatggattcaaagtgggcatgaagctagaaggcgtggaccctgaccaccaggcaatg
tactgcgtccttactgtggctgaggtttgtggatataggataaaacttcactttgacggt
tattctgattgctatgacttctgggtaaatgcagatgctctggacattcacccagtaggc
tggtgtgagaagactggccataagctccgccctccaaaagggtataaagaagaagaattt
aattggcagtcctaccttaagacttgcaaagcccaggctgctcccaagtcattatttgaa
aatcagaacataacagtgatcccgtcaggctttcgagttgggatgaagctcgaggctgca
gacaaaaagagcccttctgtcatctgtgttgctacggtaacagatatggtggacaatcgt
ttcctggtacattttgacaactgggatgagagctatgactattggtgtgaatcaaacagt
ccacacattcatccagtcggctggtgtaaagagcacagaagaaccctgattactccacca
ggctattctcatgtgaaacacttttcctgggataaatatttagaagaaaccaattcttta
cctgctcctgcaagagctttcaaagtgaaacctccacatggattccagaagaaaatgaag
ctggaagctgtggacaaaagaaacccgctgttcatcagagtagcaactgtagccgacacg
gatgaccaccggataaaggttcactttgatggctggagcagttgctatgactactggatt
gatgcagactctccagatattcaccccgtgggctggtgttccaagaccgggcaccctctt
caggctccgctaagccctgcagaattaatggaaccatcagaaaccggaggatgtccaact
ctaggctgcaggggtgttggtcattttaaaaaatcgagatacctgggcactcagagtggt
gccaactgtccctattcagaaatcaacctgagtaaggaacgcatcttcccagaccgccta
agtggtgacacctctccacctactactccctcgttcccaaggagtaaaaggatggacacc
agagaaagttcctcgtctcctgaaaccagggaaaagcatgccaataacttcaaagaagat
tctgaaaagaaaaaagaaaatgaagtaaagacatcagccgaagccaaagttgttcgggaa
gagcctacccctagtgtacagcagagtcagccacctcagcaggtgcagcaagtgcagcat
gctcaacctcctcagcaggcacagaaggctccgcaggcccagcaggcccagcaagcccag
caggcccagcaggctccacaggccccacagactccacagccccagcaggcgccacaggtc
cagcaggcccagcaggctccacaggctcagcaggcccagcagccccagcaggcccagcag
cctcagcaggccccacccgtccaacagcctcagcaggttcaacaggctcagcccacccag
cagcaagcccagacccagcagcaggcccagcgacgctcagcagtatttctctcctttaag
cctcccattccgtgtctgcccttgcgctgggagcagcagagcaagcttcttccgactgtc
gctggtatcccagctagtagagtttccaaatggagcacagacgaggtgtcagaattcatt
cagagcttgcctgggtgtgaagaacatggaaaggtgtttaaggatgaacaaattgatgga
gaagcatttttactcatgacccaaacagacattgttaaaatcatgagcattaagctgggc
ccagctctcaaaattttcaactctattctgatgttcaaagctgcggagaagaattcccac
aatgaactgtga

DBGET integrated database retrieval system