KEGG   Mus musculus (house mouse): 237422
Entry
237422            CDS       T01002                                 
Symbol
Ric8b, BC051080, Ric-8, Ric-8b
Name
(RefSeq) RIC8 guanine nucleotide exchange factor B
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Ric8
Other DBs
NCBI-GeneID: 237422
NCBI-ProteinID: NP_001013459
MGI: 2682307
Ensembl: ENSMUSG00000035620
UniProt: Q80XE1
Position
10:84753136..84854201
AA seq 520 aa
MDEERALYIVRAGEAGAIERVLRDYSDKHRATFKFESADEDKRKKLCEGIFKVLVKEVPT
TCQVSCLEVLRILSRDKKILVPVTTKENMQILLRLAKLHESDDSLEKVSEFPVIVESLKC
LCNIVFNSQMAQQLSLELNLAAKLCNLLRKCKDRKFINDIKCFDLRLLFVLSLLHTDIRS
QLRYELQGLPLLTQILESAFSIKWTDEYESAIDHNGPPLSPQETDCAIEALKALFNVTVD
SWKVHKESDSHQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL
THEETAQEAATLDELPSDKTTEKDTALKNSTMVYNGMNMEAIHVLLNFMEKRIDKGSSYR
EGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGV
KQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRGDNWYSEDEDTDTEEYKN
AKPKEELLKPMGLKPDGTITPLEEALSQYSVIEETSSDTD
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggatgaagagcgcgccctctacatcgtccgggccggcgaggcgggggctatcgagcgg
gtcctgagggattacagcgacaagcatagggctactttcaaatttgaatcagcagatgaa
gataaaagaaagaaactctgtgaaggcatatttaaggtccttgtcaaggaggtcccaacg
acatgccaagtgtcctgcctggaagtactccgcattctctccagagacaaaaagatctta
gttcctgtaacaactaaggaaaatatgcaaatactgctgagactagccaagctccacgag
tcagacgattctttggagaaggtgtcagagttcccagttattgtggaatcattgaagtgt
ctgtgtaacatcgtgttcaacagtcagatggcacagcagcttagcctggaactgaatctc
gctgcaaagctctgtaacctcctaaggaagtgcaaggaccgaaaatttatcaatgacata
aagtgctttgacttgcgcttgctcttcgtcttgtcacttttgcacactgacatcaggtca
caattgcgctatgagctccagggactcccgctgctaacccagatcttggaaagtgccttt
agcatcaagtggaccgatgagtatgagtcggccatagaccataatggacctcctctctca
cctcaggagacagactgtgccattgaggccctcaaagctctgttcaatgtgacggtagac
agttggaaggtgcataaagagagcgattctcatcagtttcgtgtcatggcagctgtcctt
cgccattgtttactaattgtaggtccaactgaagacaaaaccgaagagctgcacagtaat
gccgtcaaccttttaagcaatgttccagtctcttgtttggatgttctcatttgtccatta
acccatgaagaaacagcccaagaggcagcaactctagatgaactgcccagtgataaaaca
acggagaaagacacagctttgaaaaacagtaccatggtatacaatggcatgaatatggag
gccattcacgttttactcaattttatggagaagagaattgataagggaagcagctataga
gagggtctaactccagttctcagcttattaacagaatgttcccgagcccatcggaacatc
cgaaaatttctcaaagatcaggttttaccgcctttgagagatgtgacaaatcgaccagaa
gtcggctcaaccgtgagaaataagctggttcgtctcatgacacatgttgacctcggagtc
aagcagattgctgctgagttcctttttgtcctttgcaaagagagagtggatagcctgctg
aaatacactggctatgggaacgctgcaggactcttggcggccaggggcctcttggctgga
ggaagaggagataattggtactcagaggacgaggacacggacactgaagaatacaaaaac
gcaaaaccaaaagaggagttgcttaaaccaatgggactaaaacctgacgggacaataacg
cctttggaggaagcactcagccagtattctgtcatcgaagagaccagctcggacacagac
tga

DBGET integrated database retrieval system