KEGG   Mus musculus (house mouse): 237504
Entry
237504            CDS       T01002                                 
Symbol
Rassf9, AW322107, Pamci
Name
(RefSeq) Ras association (RalGDS/AF-6) domain family (N-terminal) member 9
  KO
K09856  Ras association domain-containing protein 9/10
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    237504 (Rassf9)
SSDB
Motif
Pfam: RA ALS2CR8 CENP-H DUF3087
Other DBs
NCBI-GeneID: 237504
NCBI-ProteinID: NP_666352
MGI: 2384307
Ensembl: ENSMUSG00000044921
UniProt: Q8K342
Position
10:102348083..102385598
AA seq 435 aa
MAPFGRNLLKTRHKNRSPTKDMDPEEKEIVVWVCQDEKIVCGLTKRTTSIDVIQALLEEH
EATFGEKRFLLGKASDYCIVEKWRGSERALPPLTRILKLWKAWGDEQPNMQFVLVKTDAF
LPVPLWRTAETKLVQNNEKPWELSPANYMKTLPPDKQKRIVRKTFRKLAKIRQDTSSHDR
DNMECLVHLIISQDHTIHQQVQRMKELDMEIEKCEAKIHLDRVGNDGANYVHEAYLMPRL
SDEEQKLDIQAEINQTLEDLNDSEGMAQLEEQLQYYRALIDKLSAEIEREVKGAGIDGIE
DMEGAAACELENSDLESVKCDLETSMKAGLTIHSHLSGIQREIKYSDSLLQMKAREYELL
AKEFSSLHISNKDGCQGKENRGKEAEAPSSNGETPPLTQRVFNIYTNDTDSDTGISSNHS
QDSETTLGDVLLLAT
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggctccctttggaagaaacttactgaagacacgacataaaaacagatctccaactaaa
gacatggatcctgaagagaaggaaattgtggtttgggtttgccaggacgagaagattgtc
tgcggattaactaaacgcaccacctccatcgatgttatccaggctctacttgaggaacac
gaagccacatttggagaaaagcgatttctgttgggcaaggccagtgactactgcatcgta
gaaaagtggaggggctcagagcgagcccttcctcctctgaccaggatccttaagctgtgg
aaggcttggggagatgaacagcccaacatgcagtttgttttggttaaaacggatgccttc
ctcccagttccactgtggcggaccgctgaaaccaaactagtgcaaaataatgaaaaacct
tgggagctcagcccagcgaattacatgaaaacattaccaccagataaacaaaaacgaatc
gtcaggaaaaccttccggaaactggccaaaattaggcaggacacaagttcccatgatcga
gacaatatggagtgtttagttcatttgattatttctcaggaccacacgattcaccagcaa
gtgcagagaatgaaagagttagatatggaaattgaaaaatgtgaagctaagatccacttg
gaccgagtagggaatgatggggctaattacgttcacgaggcctatttaatgcctaggtta
agtgatgaagagcagaagttagacattcaagctgagatcaaccagactctagaggacctg
aacgacagtgaggggatggcgcagctggaggaacagctgcaatactacagagccctcatc
gataagctctctgctgagatcgagagagaggtgaagggcgcaggcattgatgggattgaa
gacatggagggggcagctgcctgtgagctggaaaactcggatttggaaagcgttaagtgc
gatttggagacaagtatgaaagctggtttgacaatccactctcacttgagtggcatccag
agagagattaaatacagtgactcactgcttcagatgaaagcaagggagtacgaactccta
gccaaggagttcagctcacttcacattagcaacaaagatggatgtcagggaaaagaaaac
agaggaaaggaagctgaggctcccagcagcaatggggagacccctccattaactcaaagg
gtgtttaacatatatacaaatgacacggattcagacactggcatcagttcaaaccacagt
caggactctgaaacgactctgggagatgtgctcctgctggcaacttaa

DBGET integrated database retrieval system