KEGG   Mus musculus (mouse): 237542
Entry
237542            CDS       T01002                                 

Symbol
Osbpl8, AA536976, AA536995, C730029P18Rik, D330025H14Rik, ORP-8
Name
(RefSeq) oxysterol binding protein-like 8
  KO
K22285  oxysterol-binding protein-related protein 8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    237542 (Osbpl8)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    237542 (Osbpl8)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    237542 (Osbpl8)
Transporters [BR:mmu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   237542 (Osbpl8)
SSDB
Motif
Pfam: Oxysterol_BP PH PH_9
Other DBs
NCBI-GeneID: 237542
NCBI-ProteinID: NP_780698
MGI: 2443807
Ensembl: ENSMUSG00000020189
UniProt: B9EJ86
Position
10; 10 D1
AA seq 889 aa
MEAALADGEPDRSSLLGDSKDVLGPSTVVANSDEPQHLTPGKMSQRQGRDANPTPTRDLP
QPSLSPASLHSQGFERGKEDISQNKDDSSLSMSKSKSESKLYNGSEKDSSTSSKLTKKES
LKVQKKNYREEKKRATKELLSTITDPSVIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYK
TQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPS
SYLIIRATSESDGRCWMDALELALKCSSLLKRTMVREGKEHDLSISSDSTHVTLYGLLRA
NNLHSGDNFQLNDSEIERQHFKDQDLYSDKSDKENDPEHDESDNEVLGKSEESDTDTSER
QDDSYIDPEPVEPLKETTYMEQSHEELGEAGEASQTETVSEENKSLIWTLLKQVRPGMDL
SRVVLPTFILEPRSFLDKLSDYYYHADFLSEAALEENPYFRLKKVVKWYLSGFYKKPKGL
KKPYNPILGETFRCLWIHPRTNSKTFYIAEQVSHHPPISAFYVSNRKDGFCLSGSILAKS
KFYGNSLSAILEGEARLTFLNRGEDYVMTMPYAHCKGILYGTMTLELGGTVNITCQKTGY
SAILEFKLKPFLGSSDYVNQISGKLKLGKEVLATLEGHWDSEVFINDKKTDNSEIFWNPT
PDIKQWRLIRHTVKFEEQDDFESEKLWQRVTKAINAKDQTEATQEKYVLEEAQRQAARDR
KTKTQEWVCKLFELDPLTGEWHYKFSDTRPWDPLNDMIQFEKDGVIQTKVKHRTPMVSVP
KMKHKPTRQQKKVVKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIDLGDIQSSIESIKQT
QEEIKRNIMALRNHLLSSTPATDYFLQQKDYFVIFLLILLQVIINFIFK
NT seq 2670 nt   +upstreamnt  +downstreamnt
atggaggcagccttagcagacggagaacctgacagatcttcgcttcttggtgatagcaaa
gatgtccttgggccatcaactgttgtagcgaacagtgacgaacctcagcatttgacccca
ggaaagatgagtcagcgccaaggcagagacgctaacccaaccccaactagagatctgcct
cagccttctctcagccccgccagccttcacagccagggttttgaaagaggaaaagaagac
atttctcaaaataaagatgactcttcactttcaatgtcaaagagcaagtctgaatctaaa
ctatataatggctcagaaaaggacagttcaacttcaagtaaactcacgaagaaagagtct
cttaaggtacaaaagaaaaactaccgtgaagagaagaagagagccacgaaggagttactc
agcaccatcacagacccctctgtcattgtcatggccgactggctgaagattcgtggtacc
ctgaagagctggaccaagctgtggtgtgtgttgaaacctggcgtgcttctgatctataaa
acacaaaaaaatggtcagtgggtcggaacagtccttctgaatgcttgtgagatcattgaa
cgtccatcaaaaaaggatggcttttgtttcaagcttttccatcctttggagcagtctatt
tgggcagtgaagggtcctaaaggtgaagcggttggctccataacccagcctctacctagc
agctacttgattatccgagctacttcagagtcagatggaaggtgctggatggatgctttg
gagttggctttgaagtgttccagtctccttaagcggaccatggtgagggaggggaaggag
cacgacctgagcatctcctcagacagcacacacgtgacgctgtatggcttactgcgcgct
aacaatctccacagtggcgacaacttccagttgaatgacagtgagatcgaaagacagcac
tttaaggaccaagatttgtactctgataaatctgacaaggagaacgacccggagcacgat
gagtctgacaacgaggtgctggggaagagcgaggagagcgacacagacacgtccgaaagg
caagacgactcgtacatcgaccctgagcctgtggagcccttaaaggagaccacctacatg
gagcagagccacgaagaactgggagaggcaggtgaggcctctcaaacggaaactgtgtct
gaagaaaacaaaagccttatctggacgctgctcaagcaagtccgtcccggcatggaccta
tccagggtggttcttcctacgtttattttggagccccgctctttcctggataagctttca
gattactactaccacgccgatttcctgtctgaagctgctctagaagaaaatccgtatttc
cgtttgaagaaagtcgtgaaatggtatttgtcaggattttataagaagccaaagggacta
aagaaaccatataatcctatacttggtgagactttccgatgtttatggattcatcccaga
acaaacagcaaaactttctatattgctgaacaggtgtcccatcacccaccaatatctgcc
ttttatgtcagtaaccggaaagatgggttttgccttagtggtagcatcctggctaagtcc
aagttttatggaaactcgttatctgccatattggagggagaagcccggttaactttcttg
aacagaggtgaagattacgtcatgacaatgccatatgctcactgtaaaggaattctttat
ggcacaatgaccctggagcttggtggaactgtcaatattacctgtcagaagactggatac
agtgcgatacttgaatttaaactaaagccatttctagggagtagtgattatgttaaccaa
atatcagggaaacttaaattgggaaaagaagtcctagctactttggaaggccattgggat
agtgaagttttcattaatgacaaaaagactgataactcagagattttctggaatccaact
cctgacattaaacagtggagattaataaggcacactgtaaagtttgaagaacaggatgat
ttcgaatcagagaaactctggcaacgagtgacaaaagctataaatgccaaagaccaaacg
gaagctactcaagaaaagtatgttctggaagaagctcaaagacaagctgccagagatcga
aaaacaaaaactcaagagtgggtttgtaagttatttgaacttgacccactcactggagaa
tggcactataagttttcagatactcgaccatgggacccacttaatgatatgatacaattt
gaaaaagatggagttatccagaccaaagtgaaacatcgcactccaatggttagtgttcca
aaaatgaaacataaaccaacaaggcagcagaagaaagtggtaaaaggctattcttcccca
gaacctgacatccaggattcctctggaagtgaagctcaatctgtaaaaccaagtacacga
aggaagaaggggatagacctgggagacattcagagttccattgagtctataaagcagaca
caggaagagattaaaagaaatattatggctcttcgaaatcatttactttcaagtacacct
gctacagattattttctgcaacagaaagactacttcgtcattttccttctgattttgctt
caagtcataataaactttatatttaagtag

DBGET integrated database retrieval system