KEGG   Mus musculus (mouse): 237553Help
Entry
237553            CDS       T01002                                 

Gene name
Trhde, 9330155P21Rik
Definition
(RefSeq) TRH-degrading enzyme
  KO
K01306  pyroglutamyl-peptidase II [EC:3.4.19.6]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    237553 (Trhde)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.6  pyroglutamyl-peptidase II
     237553 (Trhde)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M1
   237553 (Trhde)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Motif
Other DBs
NCBI-GeneID: 237553
NCBI-ProteinID: NP_666353
MGI: 2384311
Ensembl: ENSMUSG00000050663
Vega: OTTMUSG00000025680
UniProt: Q8K093 Q8BZN0
Position
10; 10 D2
AA seq 1025 aa AA seqDB search
MGEDDAALRASGRGLSDPWADSVGVRPRTTERHIAVHKRLVLAFAVSIVALLAVTMLAVL
LSLRFDECGASAAMPGTDGGLGGFPERDSNSSFPGSARRNHHAGGESSQRESGEVGTPGT
PSAQPPSEEEREQWQPWTQLRLSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRY
VVLHASRVAVEKVQVAEDRAFGAVPVAGFFLYPQTQVLVVVLNRTLDAQRHYNLKIIYNA
LIENELLGFFRSSYVIHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYL
SLSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPD
AIRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRI
LLDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYP
AWNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLRATDIDRVFDWIAYKKGAALIRMLAN
FMGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALRRNGKYVNIQEVMDQWTLQMGYPV
ITILGNTTAENRILITQQHFIYDIGAKTKALQLQNSSYLWQIPLTIVVGNRSHVSSEAII
WVSNKSEHHRIAYLDRGSWILGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAA
LIDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNE
YILKQVATTYIKLGWPRNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISD
WISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRN
LLSRLLNLSLNSEVVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNS
KLISGVTEFLNTEGELKELKNFMKSYDGVASASFSRAVETVEANVRWKRFYQDELFQWLG
KAMRH
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagacgacgccgcgctccgggcaagcggcagggggctctcggacccgtgggct
gactcggtgggagtgagaccccgcaccacggagcgccacatcgcagtgcacaagaggctt
gtgctggcctttgccgtgtccatcgtggcactgctggctgtcaccatgctggccgtcctg
ctcagcttgcgattcgacgagtgtggagcgagcgcggcgatgcctggcaccgacggtggc
ctcgggggtttccccgagcgcgacagcaacagcagctttccaggttctgcccggcgcaac
caccacgcgggtggggaatcctctcagcgtgagagcggcgaggtgggcaccccggggacc
ccgtctgcccagccgccgtcggaggaagagcgggagcagtggcagccctggacacagctg
cgcctatccggccacctcaagccgctgcactacaatttgatgctcaccgctttcatggag
aacttcaccttctctggggaggtcaacgtggagatcgcgtgccggaacgccacccgctac
gtggtactgcacgcctcccgagtggcggtggagaaggtgcaagtagctgaagacagggcg
ttcggggctgtcccggttgcaggctttttcctctacccacaaacgcaggtcttggtggtg
gtattgaacagaaccctggacgcgcagaggcattacaatctgaagattatctacaatgcc
ctgatagagaacgagcttttgggcttcttccgcagctcctacgtgatccacggggagaga
agattccttggtgttactcagttttcacctacacatgccaggaaggcgtttccgtgtttc
gatgaaccaatctacaaggccactttcaaaatcagcatcaaacatcaagcaacctatttg
tctctatccaacatgccagtggaaacgtctgtgttcgaggaagatggatgggtgacagat
cacttttcacagacccctctcatgtctacatattatttagcctgggcgatttgcaacttc
acatacagagaaactaccaccaagagtggggttgtagtccgattatatgcgagacccgac
gctatcagaagaggatccggggactatgctctccacattacaaagagattaatagaattt
tatgaagactactttaaagtgccctattctttgccaaaactagatcttttagctgtgcct
aagcatccttatgctgctatggagaactggggactaagtatttttgtggaacaaagaata
ctgctggatcccagtgtgtcatctatttcttatttgctggatgtcaccatggtcattgtt
catgaaatatgtcaccagtggtttggtgaccttgtgactccagtttggtgggaagatgtg
tggttgaaggaaggctttgctcactactttgaatttgtgggtacagactacctctaccct
gcctggaacatggagaagcagagatttctgacagatgttctgcatgaagtgatgctactt
gatggcttggccagttcccatccagtatcacaggaagtgctacgggcaacagatattgac
agagtgttcgactggatcgcatacaaaaagggtgctgctctaattagaatgctggctaat
tttatgggtcattcagtttttcagaggggattgcaagattatttaaccattcacaagtat
ggcaatgcagccagaaatgatctctggaatacattatcagaggctttaagaaggaatgga
aaatacgtgaacatacaagaagtaatggatcagtggacactgcagatgggatatcctgtt
atcactatcctgggaaacacgacggcagaaaatagaatacttatcacccaacagcatttc
atttatgacattggtgctaaaactaaagcacttcaacttcaaaacagcagttacctgtgg
cagattccattaaccattgtggtaggaaatagaagccatgtgtcttcagaagcaattatt
tgggtgtctaacaaatcagaacatcacagaatagcgtacttagacagaggaagctggatc
cttgggaacatcaatcaaaccggctactttagagtcaactatgacctaaggaactggaga
ttactaatcgatcagttaatcaggaaccacgaggtactttctgtcagtaaccgcgcggct
ttgatcgatgatgccttcagcctggccagggcaggctatttgcctcagaatatcccccta
gagatcatcagatacctgtctgaggaaaaggattttcttccttggcacgctgccagccga
gctctttatcctctggataaattactggaccgcatggagaactacaatatcttcaatgaa
tatattctaaaacaagttgcaacaacatacatcaagcttggatggccaagaaataacttc
aatggatctctcgttcaagcctcctaccaacatgaggagctacggagggaagtgataatg
ttggcatgtagttttgggaacaagcactgtcaccagcaggcatcaacacttatttcagac
tggatttccagcaacagaaacagaatacccctgaatgttagagacatcgtctactgcaca
ggagtgtcactgctggatgaggatgtctgggagtttatctggatgaaattccactctacc
actgcagtttctgagaaaaagatactgctggaggctctaacttgcagcgatgacaggaat
ttattaagtaggcttctaaatctgtctctgaattctgaggtggtgttggatcaagatgca
attgatgtaattatccacgtagccagaaatccacatggccgagaccttgcctggaagttt
ttcagagacaaatggaaaatactaaataccaggtatggagaagcactgtttatgaattcc
aaacttatcagtggagttacagaatttcttaatacagaaggtgaacttaaagagctaaag
aatttcatgaagtcctatgatggggtagcctctgcttctttctcacgagctgtggaaact
gtggaagccaatgtgcgctggaaaaggttttaccaagatgagcttttccagtggctggga
aaagccatgagacactaa

DBGET integrated database retrieval system