KEGG   Mus musculus (mouse): 237711
Entry
237711            CDS       T01002                                 

Symbol
Eml6, 2900083P10Rik, C230094A16Rik, EMAP-6
Name
(RefSeq) echinoderm microtubule associated protein like 6
  KO
K18598  echinoderm microtubule-associated protein-like 6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99993 Cell motility
    237711 (Eml6)
SSDB
Motif
Pfam: WD40 HELP ANAPC4_WD40 Ge1_WD40 WD40_like Nucleoporin_N Frtz Cytochrom_D1
Other DBs
NCBI-GeneID: 237711
NCBI-ProteinID: NP_666128
MGI: 2442895
Ensembl: ENSMUSG00000044072
Vega: OTTMUSG00000005340
UniProt: Q5SQM0
Position
11; 11 A3.3
AA seq 1958 aa
MADRTAPRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGH
NDDIISLALHPDKTLIATGQVGKEPYICIWNSYNVHTVSILKDVHTHGVACLAFDSDGQH
LASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQPNRMVSCGVKHIKFWTLC
GNALTAKRGIFGKTGDLQTILCLACAKEDITYSGALNGDIYVWKGLTLVRTIQGAHSAGI
FSLYACEEGFATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWKADRLLAGT
QDSEIFEVIVRERDKPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALI
ARCNMEEAVRSVSFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDG
SYLAVGSNDGPVDVYAVAQRYKKIGECNKSLSFITHIDWSLDSKYLQTNDGAGERLFYKM
PSGKPLTSKEEIKGIPWASWTCVRGPEVSGIWPKYTEVIDINSVDANYNSSVLVSGDDFG
LVKLFKFPCLKKGAKFRKYVGHSAHVTNVRWSHDFQWVLSTGGADHSVFQWRFIPEAVSN
GVLETTPQEGGADSYSEESDSDFSDVPELDSDIEQETQINYDRQVYKEDLPQLKQQSKEK
NHAVPFLKREKAPEDSLKLQFIHGYRGYDCRNNLFYTQAGEVVYHIAAVAVVYNRQQHAQ
RLYLGHDDDILSLTIHPVKDYVATGQVGRDAAVHVWDTQTLKCLSLLKGHHQRGVCALDF
SADGKCLVSVGLDDFHSVVFWDWKKGEKIATTRGHKDKIFVVKCNPQHADKLVTVGIKHI
KFWQQAGGGFTSKRGSFGSAGKLETMMCVSYGRMEDLVFSGAATGDIFIWKDVLLLKTVK
AHDGPVFAMYALDKGFVTGGKDGIVELWDDMFERCLKTYAIKRTALSTSSKGLLLEDNPS
IRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDK
TLRIWELSSQHRMLAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMLSFHH
RKEMISDIKFSKDTGKYLAVASHDNFVDIYNVLTSKRVGICKGASSYITHIDWDSRGKLL
QVNSGAKEQLFFEAPRGRKHTIRPSEAEKIEWDTWTCVLGPTCEGIWPAHSDVTDVNAAN
LTKDGSLLATGDDFGFVKLFSYPVKGQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGAD
TALMIWTREFVGTQESKLVDSEESDTDAEEDGGYDSDVAREKAIDYTTKIYAVSIREMEG
TKPHQQLKEVSMEERPPVSRAAPQPEKLQKNNITKKKKLVEELALDHVFGYRGFDCRNNL
HYLNDGADIIFHTAAAGIVQNLSTGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIGTT
PSIHIWDAMTKHTLSMLRCFHTKGVNYINFSATGKLLVSVGVDPEHTITVWRWQEGTKVA
SRGGHLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSALLYKKGVIGSMEAAKMQTMLS
VAFGANNLTFTGAINGDVYVWKEHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTK
EGGAVKLWDQEMKRCRAFQLETGQLVECVRSVCRGKGKILVGTKDGEIIEVGEKSAASNI
LIDGHMEGEIWGLATHPSKDMFISASNDGTARIWDLADKKLLNKVNLGHAARCAAYSPDG
EMVAIGMKNGEFVILLVNTLKVWGKKRDRKSAIQDIRISPDNRFLAVGSSEQTVDFYDLT
QGTSLNRIGYCKDIPSFVIQMDFSADSKYIQVSTGAYKRQVHEVPLGKQVTEAMVVEKIT
WASWTSVLGDEVIGIWPRNADKADVNCACVTHAGLNIVTGDDFGLLKLFDFPCTEKFAKH
KRYFGHSAHVTNIRFSSDDKYVVSTGGDDCSVFVWRCL
NT seq 5877 nt   +upstreamnt  +downstreamnt
atggcggatcggacagctcccagatgccagctccggctggagtgggtgtacgggtaccgg
ggtcaccagtgccgcaacaacctgtactacaccgccggcaaggaggtggtctactttgta
gctggggtaggggtggtgtacaacacccgagagcacagccaaaaattcttcctgggacac
aacgacgacattatcagccttgccttacacccagataaaactctgattgcaactggccag
gttgggaaggagccatatatatgcatatggaattcctataatgtccatactgtgtctatt
cttaaagatgtccatacacacggagttgcatgcctggcttttgactcggatggacagcat
ttagcctctgtgggattagatgccaaaaacacagtctgcatttgggactggagaaaggga
aaacttctggcctcagctactggccattctgaccggatttttgatatttcctgggatcca
tatcagccaaacagaatggttagctgcggagtgaagcatataaagttttggacactatgt
ggaaatgccctgactgcaaaaagaggcatatttggcaaaacaggagatcttcagactatc
ctttgccttgcatgtgccaaagaagacatcacttactctggtgctttaaacggtgacatc
tatgtctggaaagggctcaccttagtccgcactattcaaggagcacatagtgctgggatc
ttcagcctgtatgcttgtgaagaaggctttgctactggtgggcgagatggttgcatacga
ttatgggacactgatttcaaaccaataaccaaaattgatctcagggagacggaacaagga
tataaaggcctctctattcggagtgtgtgctggaaagctgaccgccttctagcaggaacc
caggacagtgagatatttgaagtcattgttcgagagcgagataagccaatgctcattctt
cagggccactgcgagggggaactgtgggctctggcattgcaccccaagaaacctctggct
gtgacaggcagtgatgaccgctctgtcagactgtggagtcttgctgaccatgccttgatt
gcccgctgcaatatggaggaagcagttcgtagtgtatccttcagcccagatggatctcag
ttggccctaggcatgaaggacggctctttcattgtcctccgagtcagagatatgacagaa
gtcgttcatatcaaggacaggaaagaagtcattcatgagatgaaattctccccagatggc
tcttacctcgcagtaggatccaatgatggccctgtagatgtctacgctgttgcccagcgc
tataagaaaataggagaatgcaacaagtccctgagtttcatcacgcacatcgactggtct
ctggatagtaaatacttgcaaaccaacgatggtgctggggagagactgttctacaaaatg
ccatcagggaagcctttaacaagtaaagaagaaatcaaggggattccctgggcctcctgg
acgtgtgtgagaggccctgaagtgagtggaatttggcccaaatacactgaggttattgac
atcaattcagtggacgccaattataacagttcagtgttggtttctggagatgattttgga
ctggtcaaattgttcaaatttccttgtctcaaaaaaggagccaaatttagaaagtatgtg
ggccactctgcacatgtcaccaacgtccgttggtcccacgatttccagtgggtgttaagc
acaggaggagctgatcattctgttttccagtggagatttatcccagaagcagtcagcaat
ggcgtgttggaaaccacaccccaggaaggtggtgccgactcctatagtgaggaatctgac
tctgacttctctgacgttccggaactggactctgatattgagcaggaaactcagatcaat
tacgatcgccaggtttacaaagaagatctacctcagctaaagcaacaaagtaaagagaaa
aaccatgcagtgccattcctgaagagggagaaggctcctgaggatagcctgaaactgcag
ttcatacatggttacagaggctatgactgtagaaacaatctgttctacacacaagctgga
gaagtggtgtaccacattgctgcagttgctgtggtatacaaccggcaacagcacgcccag
aggttatacctggggcacgatgatgacattctcagcctgaccatccatccggtgaaggac
tatgtagccactggacaggttggaagagatgctgctgttcatgtgtgggacactcagact
ctaaaatgtttgtcattactgaaagggcaccatcagagaggagtgtgtgctctggacttt
tcagctgacggaaaatgtctcgtgtcggttggtttagacgattttcacagtgttgtgttt
tgggactggaaaaagggagaaaagatagccacaaccaggggacacaaagacaaaatattt
gtggtaaagtgtaatccacagcatgctgacaagttggtgacagttgggattaagcatatc
aagttctggcaacaagcaggtgggggcttcacctctaaaagaggaagttttggaagtgct
ggaaagttggaaacaatgatgtgtgtttcttatgggcgaatggaagatctggtgttctca
ggtgcagccactggagatatttttatctggaaggacgttctgctactgaagacagtgaag
gctcatgatgggcctgtgtttgccatgtatgcattagacaagggctttgtaacaggtgga
aaggatggaattgtggaactctgggatgatatgtttgaaagatgcttgaagacttatgcc
atcaaaaggactgcattgtcaaccagctcaaaaggactgcttttggaggataacccttca
attcgtgcaattaccctagggcatggacacattctcgtggggacaaaaaatggagagatt
ctagaaattgataagagtggcccgatgaccctgcttgttcagggacacatggaaggggaa
gtgtgggggctggcagcacacccgctcctgcccatctgcgcgacagtaagtgatgacaaa
acacttcggatctgggaattatcctcccagcaccgcatgctggctgtacggaaacttaaa
aaaggaggaagatgttgtgctttctcccctgatgggaaagccctagcagttggattgaat
gatggaagtttcttggtggtgaatgctgacacagtggaagacatgctctccttccatcac
agaaaagaaatgatctctgatataaaattttcaaaagatacaggaaaataccttgctgtg
gcatctcatgataacttcgtggatatctacaacgtgcttacaagcaagagggttggcatc
tgtaaaggagcttctagttacatcacacacattgactgggactctagagggaaattactg
caagttaattcaggtgccaaagaacagcttttctttgaagctccaagaggcagaaaacac
acaataaggccatcagaggctgagaagatagaatgggacacctggacctgtgtcctgggg
cccacctgtgaaggaatctggcctgctcacagcgatgtgactgacgtcaatgctgccaat
cttaccaaagatggctccctcttagcaactggggatgactttggttttgtgaagcttttt
tcatatcctgtcaagggacagcatgcaagatttaagaaatatgtggggcacagcgcacac
gttaccaatgtgaggtggctacacaatgactctgtgctgctcactgtaggaggtgctgac
acagccttgatgatctggaccagggaatttgtggggacgcaggagagcaagctggttgat
agtgaggagtcagacacagatgcagaagaagatggaggctatgacagtgatgtcgctaga
gagaaagccattgactataccaccaagatctatgctgtgagcatcagggaaatggaaggc
accaaaccacaccagcagctaaaagaggtgtccatggaagaaagaccacccgttagccgt
gcagccccccagcccgagaaactccagaagaacaacatcaccaagaaaaagaagctggtt
gaggagctggctctggaccacgtgtttggctaccgaggatttgactgccgcaacaacctg
cattaccttaacgatggtgccgacatcattttccacactgcggcagctggcattgtgcag
aacctctccacaggcagccagagcttctacctggagcacacggatgacatcctctgcctc
acagtgaatcagcacccaaagtacagaaatgtggtggctaccagccagatagggacaaca
ccttcaattcatatctgggatgcaatgaccaaacacaccctttccatgctgcggtgcttc
cacaccaagggggtgaattacatcaacttcagtgcaaccgggaagctcctggtgtctgtg
ggcgtggatccagagcacaccatcactgtctggagatggcaagaaggtaccaaggttgcc
agccgagggggccacctggaacgaatatttgtggtggaatttcgccctgactcagacaca
caatttgtatctgttggagtcaaacatatgaagttctggactctggcaggaagtgctctg
ctgtacaagaaaggggtcatcgggtctatggaagctgccaagatgcaaacgatgctgtcc
gtggcttttggtgctaacaaccttacttttactggtgccatcaatggagatgtctatgtc
tggaaggagcacttcctcatccggctggtggccaaggctcacacaggtcctgtctttaca
atgtacaccaccctccgagatgggcttattgtgactggcggaaaagaacgaccgactaag
gaaggaggagctgtaaagttgtgggaccaggagatgaagcgctgtcgggccttccagctg
gaaacagggcagctggtggaatgtgtgcgctcggtgtgccgtggcaagggaaaaatctta
gtaggaaccaaagatggtgaaataattgaagttggggaaaaaagcgctgcttcaaacatc
ctgattgatggacacatggagggggagatctggggcctagccacacacccctccaaggac
atgttcatctcagccagcaatgatggcacagcaaggatctgggacctggctgacaagaaa
ctgttaaacaaggtgaacctgggccatgcggccaggtgtgcagcctatagccctgatggg
gagatggtggccattggcatgaagaatggagagtttgtcatcttgctggtgaacaccctg
aaagtttgggggaaaaaacgagaccggaaatctgccatccaagatatcagaatcagccca
gacaacagattcttagctgtggggtcttctgagcagacagttgacttctatgaccttact
cagggcacaagtctgaaccggatcggctactgcaaagacatcccaagctttgtcattcag
atggacttttctgcagacagcaaatacattcaggtgtcaacaggagcctataagcgccaa
gtacatgaagttcccctggggaagcaagtaactgaagccatggttgttgagaagatcacc
tgggcttcctggacaagtgttctcggagatgaagtcattggaatctggccacgaaacgca
gacaaggctgatgtcaactgtgcatgtgtgacccatgctggcttgaacattgtcacaggg
gatgacttcgggctgctgaagctctttgattttccatgcacagaaaaattcgccaagcac
aaacgttactttggtcactctgctcatgtgacgaacatccgcttctcttccgatgacaag
tatgtggtcagcacaggaggagacgactgcagtgtatttgtgtggcgatgtctgtaa

DBGET integrated database retrieval system