KEGG   Mus musculus (mouse): 237754Help
Entry
237754            CDS       T01002                                 

Gene name
Btnl9, B430208I01, Btn3, D330012D11Rik
Definition
(RefSeq) butyrophilin-like 9
  KO
K06712  butyrophilin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    237754 (Btnl9)
   04090 CD molecules [BR:mmu04090]
    237754 (Btnl9)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   237754 (Btnl9)
CD molecules [BR:mmu04090]
 Proteins
  237754 (Btnl9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRY V-set SPRY Ig_3 I-set ig C2-set_2 Ig_2 V-set_CD47
Motif
Other DBs
NCBI-GeneID: 237754
NCBI-ProteinID: NP_766381
MGI: 2442439
Ensembl: ENSMUSG00000040283
Vega: OTTMUSG00000005543
UniProt: Q8BJE2
Position
11; 11 B1.2
AA seq 536 aa AA seqDB search
MADFSVFLGFLKQIPRCLSIFFTYLLFLQLWEVNSDKVWVLGPEESILARVGEAVEFPCR
LSSYQDAEHMEIRWFRAQVSNVVYLYQEPQGRSSLQMAQFRNRTLFEAYDIAEGSVNLHI
LKVLPSDEGRYGCRFLSDNFSGEATWELEVAGSGSDPHISLQGFSGEGIQLQCSSSGWYP
KPKVQWRGHQGQCLSPESEAITQNAQGLFSLETSVIVRGGAHSNVSCIIQNPLLPQKKEF
VIQIADVFLPRMSPWKKAFVGTLVVLPLSLIVLTMLALRYFYKLRSFQEKQVKQGEEVRE
KLQTELDWRRSEGQAEWRAAQQYAADVTLDPATAHPSLEVSNNGKTVSSRLGVPSIAAGD
PQRFSEQTCVLSRERFSSGRHYWEVHVGRRSRWFLGACLESVERSGPARLSPAAGYWVMG
LWNRCEYFVLDPHRVALALRVPPRRIGVLLDYEAGKLSFFNVSDGSHIFSFTDTFSGALR
AYLRPRAHDGSEHPDPMTICSLPVRGPQVLEENDNDNWLQPYEPLDPAWAVNEAVS
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcagatttctcagtatttctggggtttctgaagcaaatacctcggtgcctcagcatc
ttcttcacctaccttctcttccttcagttgtgggaggtgaactcagacaaggtctgggtg
ttgggccctgaggagtccattttggcccgcgtcggggaagcggtggagttcccatgtcgc
ttatcatcataccaagacgcagagcacatggaaattcgctggtttcgggcccaggtctcc
aacgtggtgtacctgtaccaggagccgcaggggcgctccagcctgcagatggcacagttc
cgaaacaggaccttatttgaagcctatgacattgcagagggaagcgtgaacctacacatc
cttaaagtgcttccctccgacgagggccgatatgggtgccgctttctttctgacaacttc
tctggtgaagccacgtgggagctggaagtagcaggatcgggctcagacccacacatctcc
ctccagggcttcagtggagaaggtattcagctgcagtgcagttccagtggctggtacccc
aagccaaaggttcagtggagaggtcaccagggtcagtgcctttctccagagtctgaagcc
atcacccagaatgcccaaggcctgttcagtctggagacatccgtgattgtccgaggagga
gcccatagcaatgtgtcttgtataatccagaaccccttgctgccccagaagaaagaattc
gtgatccagattgcagatgtgttcctacccagaatgtccccctggaagaaagcgtttgtg
ggaaccctggtggtcctgccgctcagtctgattgtgctcaccatgctggcgctgcgatat
ttttacaagctgcggagcttccaagaaaaacaggtgaagcagggagaggaggtccgagag
aaacttcagacagagcttgactggagaaggtctgaaggccaggctgagtggagagcagcc
cagcaatatgcagcggatgtgaccttggatcctgccacagcgcaccctagcctggaggtc
tccaacaacggcaagaccgtgtcctcccgcctgggggtgcccagtattgcagctggggac
ccgcagcggttctcggagcagacctgcgtgctgagccgggagcgcttctccagcggccgc
cactactgggaggtgcacgtgggccggcgcagccgctggttcctgggcgcctgtctggag
tcggtggagcgctccgggcccgcgcgcctgagcccggcggctggctactgggtgatgggg
ctgtggaaccgctgcgagtacttcgtgctggacccgcatcgcgtggcactggcgctacgc
gtgcctccccggaggataggcgtcctgttggactacgaggccgggaagctgtctttcttc
aacgtgtctgatggctcgcacatcttcagcttcaccgacactttctcaggggcgctccgc
gcctacttaaggccccgagctcacgacggcagtgaacatccggatcctatgaccatctgc
tctttgccggttagagggccacaggtcctcgaagagaacgacaacgacaactggctacag
ccctatgagcctctggaccccgcctgggctgttaatgaggcagtgtcctga

DBGET integrated database retrieval system