KEGG   Mus musculus (mouse): 237782Help
Entry
237782            CDS       T01002                                 

Gene name
Smcr8, 2310076G09Rik, AI642055, D030073L15Rik
Definition
(RefSeq) Smith-Magenis syndrome chromosome region, candidate 8 homolog (human)
  KO
K23611  guanine nucleotide exchange protein SMCR8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    237782 (Smcr8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    237782 (Smcr8)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Rab associated proteins
    237782 (Smcr8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Folliculin
Motif
Other DBs
NCBI-GeneID: 237782
NCBI-ProteinID: NP_001078909
MGI: 2444720
Ensembl: ENSMUSG00000049323
Vega: OTTMUSG00000007770
UniProt: Q3UMB5
Position
11; 11 B2
AA seq 935 aa AA seqDB search
MISAPDVVAFTKEDEYEEEPYNEPALPEEYSVPLFPYASQGANPWSKLSGAKFSRDFILI
SEFSEQVGPQPLLTIPNDTKVFGTFDLNYFSLRIMSVDYQASFVGHPPGSAYPKLNFVED
SKVVLGDSKEGAFAYVHHLTLYDLEARGFVRPFCMAYISADQHKIMQQFQELSAEFSKAS
ECLKMGNRKAFAGELEKKLKDLDYTRTVLHTETEIQKKANDKGFYSSQAIEKANELANVE
KSIIEHQDLLRQIRSYPRQKTKIPDLQPGDTEHTQDQADQVSTTSNPEESANADLYTCRP
AYTPKLIKAKSTKCFDKKLKTLEELCDTEYFTQTLAQLSHIEHMFRGDLCYLLTSQIDRV
LRKQQPITNFLFEDFVEVDDRMEKQENVPSQPSQDRLPPKPVEECPIPKVLISVGSYKSS
VESVLIKMEQELGDEEYTGVEATEARSFDPQENLDYLDMDMKGSISSGESIEVLGTEKSA
SVLSKSDSQASLTVPLSPHVVRSKAVSHRTISEDSIEVLSTCPSEALIPDDFKASYPSAI
NEEEAYADNEGAIHFQASAGSPEPDETQEGNLENIPSQIDSSCCIGKESEGHLVPLPTPA
YTLSDEDSVVSIPPQRYIQKDQGLHVDFGVENTDPSPRDNSCEMFPAYELDPSCLLASRD
VSKMSLDNYSDTTSYMGSAASTSSDRIPSAPPAGLSSERHKKRAGQNALKFIRQYPFAHP
AIYSLLSGRTLVVLGEDETIVRKLVTALSIFVPNYGCYAKPVKHWISSPLHIMDFQKWKL
IGLQRVASPANVGTLHTLSRYSRYTSILDLDSKTLRCPLYRGTLVPRLADHRTQIKRGST
YYLHVQSMLTQLCSKAFLYTFCHHLHLPAHSEETQEAVASRQTSFLKLNLGLVNEDIRVV
QYLAELLKLHYMQESPGTTHPLLRFDYVPSFLYKI
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcgcccctgatgtggtggccttcaccaaggaagatgaatacgaggaagaacct
tacaatgagcccgctttgcctgaggagtactcagtccctctctttccttatgccagccag
ggggcaaacccctggtctaaactgtctggggccaagttctccagggacttcatcctcatt
tccgagttctctgagcaggtgggaccccagcccttgcttaccatccccaatgacaccaaa
gtttttggcacttttgatcttaattacttctctttgcggattatgtcggtggattaccag
gcttcattcgtaggccatcctcccggttctgcctaccccaagttgaactttgtggaagac
tctaaagtggtactgggagactctaaggaaggggcctttgcatatgtgcaccacctcacc
ttgtacgacctggaggccaggggctttgtgaggcccttttgtatggcttatatctccgca
gaccagcataaaatcatgcagcagttccaagagctctcggccgaattttccaaagcatct
gagtgcttgaagatgggcaacaggaaggcattcgctggggaacttgaaaaaaagctgaaa
gacttggattacacaaggacagtgctacacacagaaaccgagatccagaagaaagccaac
gacaagggtttttattcttctcaggcgattgagaaagccaatgaactggccaatgtggag
aagtccatcatcgaacatcaagatttgctgaggcagatccgctcataccctcgtcagaag
acgaagatccctgacttgcagcctggtgatacagagcatacccaggatcaggctgaccag
gtatccactacctctaatcctgaggagtccgctaatgcagacctttatacctgcagaccg
gcttacacccccaaactcatcaaagcaaagtccaccaagtgttttgacaagaagttgaag
accttggaggaactctgtgacactgagtatttcactcagaccctggcccagcttagccac
attgaacacatgttcagaggagacctgtgctacctcctgaccagtcagattgacagagtg
cttcgaaaacaacagcccataacgaatttcctctttgaagattttgtagaggtggatgac
aggatggaaaagcaagagaatgtaccctctcagcccagtcaggacaggctgcctcccaag
cctgtagaagaatgccccattcctaaagtgttaattagcgttggctcttacaagtccagt
gtggagtctgtattgatcaagatggagcaggaacttggcgatgaagagtacacgggggtg
gaggcaacagaggcacgcagttttgacccccaagagaacctggactacctggatatggat
atgaaagggagcatcagtagtggggaaagcattgaggtgctgggcaccgagaagtcagcc
tctgtgttgtcgaaatctgacagccaggccagcctcaccgtgccattgagcccccatgta
gtccgtagcaaagcggtcagccacaggacaatcagcgaggacagcattgaagtcttaagt
acctgcccttctgaggccctcattcctgatgactttaaggccagttacccaagtgccatt
aatgaagaagaagcctatgcggataatgagggggccatccatttccaggcaagtgccggc
tcaccagaaccggatgagactcaggagggcaacttggaaaatatcccatcccaaatagac
tccagctgctgtattggaaaggagagtgaaggtcacttggtgcctctcccaaccccagcc
tacactctttctgatgaggacagtgtggtgagcattcccccacagcgctacatacagaag
gaccaggggctccacgtggacttcggagtggaaaacactgacccttctccccgagacaac
agttgtgaaatgttcccagcttatgagctggatccaagctgccttctggctagccgagat
gttagtaagatgagcctggataactactcggataccactagctacatgggcagtgcggcc
tctaccagctcagacagaatcccctcagcacctcctgctggcctatcctctgagaggcac
aaaaagagagctggccagaatgccttaaaattcatccgccagtacccttttgcccaccca
gccatctactccctgctcagtgggaggacacttgtggtcctgggcgaagatgaaaccatt
gtcaggaagctggtgactgcactgtccatctttgttcccaactatggctgctatgccaag
ccggtgaagcactggatttcttcccctttgcatattatggatttccagaagtggaagctt
attggcctacaaagagtggcctctcctgccaatgtgggtaccctccataccctgagccgt
tacagccgttatacaagcatcctggacctggacagcaagaccctacgctgtcccctatac
aggggtacactggtaccccgcctggctgaccatcgcactcagatcaagcggggcagcaca
tactaccttcacgtccagagcatgctcacccagctctgctccaaggcattcctctacacc
ttttgtcaccacttgcatctgcccgcccacagtgaggagacacaagaagcagtggccagc
agacaaaccagcttcctaaagctaaacctggggctcgtgaacgaggacatcagagtggta
cagtacctggctgagctgttgaaactgcactatatgcaggagtcaccggggaccacccac
ccactgctcaggtttgactacgtccccagctttttgtacaaaatctaa

DBGET integrated database retrieval system