KEGG   Mus musculus (house mouse): 237806
Entry
237806            CDS       T01002                                 
Symbol
Dnah9, 9030022M04, A230091C01, C230051G16, D11Ertd686e, Dnahc9, mKIAA0357
Name
(RefSeq) dynein, axonemal, heavy chain 9
  KO
K10408  dynein axonemal heavy chain
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    237806 (Dnah9)
   05016 Huntington disease
    237806 (Dnah9)
   05022 Pathways of neurodegeneration - multiple diseases
    237806 (Dnah9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    237806 (Dnah9)
   04812 Cytoskeleton proteins [BR:mmu04812]
    237806 (Dnah9)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Dynein arm
   237806 (Dnah9)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     237806 (Dnah9)
SSDB
Motif
Pfam: MT DHC_N1 AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 AAA_lid_1 Dynein_heavy Dynein_AAA_lid AAA_5 AAA_16 AAA_30 Sigma54_activat AAA_29 AAA_19 Protoglobin DUF1672 LppA
Other DBs
NCBI-GeneID: 237806
NCBI-ProteinID: NP_001093103
MGI: 1289279
Ensembl: ENSMUSG00000056752
UniProt: B1AR51
Position
11:complement(65722150..66059379)
AA seq 4484 aa
MPGAKEQAALAESGDEEPGDPRLRLLGTFVARSLRPAAGTWERCAGTAEAGRLLQAFLDH
NAASDPRPLLVVQSGPGGLVVTPGLDAGPEPSRARAKGLFFLRTKSEPPGNHSLRGTVLC
GDLPAVPLEHLAPLLSEVIIPVLANEKNHLEWPHMVCQDIRHHAHTLKSDLLVIFEHMKG
RTLLPLPVGSEKLEFVDGHSEPVSDAIDKSTLYAVESAVIKWSHQVQVVLKRESSQALIQ
GQNPTPKVELEFWKSRCEDLEHIYNQLMTIKVKGMAELLDKLQSSYLPAFKAMFRDVEAA
LTEAQDIHVHLLPLQQHLDILENVEFPKVKGRLRPLLHVVCLIWATCKWYRSPGRLTVLL
QEICNLLIQQASNYLSPEDLLRSEVEESQKKLQVVSDTLSFFKQAFQDRREHLHTYFKED
SEVRVWDFQASLVFVRLDGFLGRVHMVEDLLKTALDLNNLEKLEFSGLRGNSLSQKVQRM
HEEFEEMYKVFLDCSYDCLDPKGTEFENDVCEFNKRVEDLDRRLGTILIQAFDDAPDVEH
AFKLLDITGTLIKRPLVAQDVSQKYLALIRMFSTELDAVRVIYSQHIQKEAEHGFSPVHK
NMPTMAGGICWAQELRQRVKGPFGNFKNIPHLYLQSAEGKRMIQKYEDLLSLLEEYERRL
YEDWCQTVSEKSQYNLSLPLLHRDPNTKQLSVNFNPQLISVLKEMNYLQPSEVKTIPETA
AAMFSSREFYRQLVANLELMANWYNKVIKILLEVEFPLVEEELQNIDLRLRAAEETLSWK
TEGIWDYAMQITNSIHDLEQRIQKTKDNVEEIQNIMKTWVSPIFKRKDGKKEWPLSLDDQ
QDHMEKYYSLIQESGLKIHALVQENLVLFAADPASSIWKSYVNYIDSMLLDGFFLAIECS
LKYLLENTECKPGLTPVFEAQLNLVTPELVFHPSLDSGVKGGLYDIVQSLVTRIFAMPSL
VPRLSPHSGSPHYQGDLEDMADLAGLRSVLMERVQNMMTLCCGYRNTLSQYSYLYVEDRK
EILGQFLLYGHVLTPEEIEAHAEDGIPENPPLLHHFKDQIDSYEKLYEEVVSLEPTKVFD
GWMRVDVRPFKASLLNTIKKWSLMFKQHLVDFVTNSLSDLDSFIRSTESGLLKRVEKGDF
QGLVEIMGHLVTLKERQSSTDDMFEPLKQTIELLKSYEQELPETVFKQLEELPEKWKNMK
KMAITVRQQVAPLQANEVALLRQRCSAFDDEQQQFQERFRKEAPFRFDSINPHQMLDAWH
VEIQHMESTMATISKSADLFEVNVPDYKQLRQCRKEACQLKELWDTIGMVTSSIRAWEAT
SWRNISVEAMDSECKQFARHIRNLDKEFRSWDAFTGLESTVLNTLTSLRAVAELQNPAIR
DRHWRQLMQATGVNFTMNQDTTLAHLLQLQLHHFEDEVRGIVDRAVKEMSMEKTLKELQT
TWASMEFQYESHARTRVPLLQSDEDLIEVLEDNQVQLQNLMMSKYVAFFLEEVSSWQKKL
STADSVISIWFEVQRTWSHLESIFIGSEDIRAQLPQDSKRFEGIDSDFRELAYDAQKTPN
VVEATNKSGLYEKLEDIQSRLCLCEKALAEYLDTKRLSFPRFYFLSSSDLLDILSNGTAP
QQVQRHLSKLFDNMAKMQFQLDASQNPTKTSLGMYSKEEEYVAFSEACDCSGQVEIWLNR
VLRHMKATVRHEMTEGVTAYEEKPRDQWLFDYPAQVALTCTQIWWTTEVGIAFARLEEGY
ESAMKDYYKKQVAQLKTLITMLIGPLSKGDRQKIMTICTIDVHARDVVAKMIAQKVDNAQ
AFLWLSQLRHRWDDEAKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHL
TMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFD
EFNRISVEVLSVVAVQVKSIQDAIRDKKQRFSFLGEEISLDPSVGIFITMNPGYAGRTEL
PENLKALFRPCAMVVPDFELISEIMLVAEGFIEARLLARKFITLYRLCKELLSKQDHYDW
GLRAIKSVLVVAGSLKRGDPDRPEDQVLMRSLRDFNIPKIVTDDMPVFMGLIGDLFPALD
VPRKRDLDFEAVVRKAIVDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGGAGTGKSQVLR
SLHKTYQIMRRRPVWTDLNPKAVTNDELFGIINPATREWKDGLFSSIMRELAIISHDGPK
WILLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLLFEISHLRTATPATVSRA
GILYINPADLGWNPPVSSWIDQREVQTERANLTILFDKYLPTCLDTLRTRFKKIIPVPEQ
SMIQMLCYLLECLLTKEDIPADCPKEIYELYFVFAAIWAFGSAVIQDQLVDYRAEFSKWW
LTEFKTVKFPSQGTVFDYYIDPETKKFEPWAKLIPQFEFDPEMPLQACLVHTSETIRVCY
FMERLMQWRRPVMLVGPAGSGKSVLVGAKLSSLNPEEYMVKNVPFNYYTTSAMLQAVLEK
PLEKKAGRNYGPPGNRKLIYFIDDMNMPEVDAYGTVQPHTVIRQHLDYGHWYDRNKLSLK
EIMNVQYISCMNPTAGSFTINPRLQRHFSVFALCFPGADALSSIYSTILTHHLKFGNFPT
TLQKSIPPLINLAVTFHQKIATTFLPTAIKFHYIFNLRDFANIFQGILFSSVECVKSTQD
LVKLYLHESSRVYRDKMVEEKDFNLFDKIQTEFLKKNFDDSEEVLKQTQNLNMYCHFANG
IGEPKYMPVQSWDLLNQTLVEALESHNEVNAVMDLVLFEDAIRHICHINRILESPRGNAL
LVGVGGSGKQSLTKLAAFISSMDVFQITLRKGYQIPDFKVDLASLCLKAGVKNLSTVFLM
TDAHVADERFLVLINDLLASGEIPDLYSDEEEENIINNVRNEVKSQGLMDSRENCWKFFI
ERVQRQLKVTLCFSPVGNKLRIRSRKFPAIVNCTAINWFHEWPQEALESVSLRFLQNTKN
IEPAVKQSISKFMAFVHISVNKTSQSYLTNEQRYNYTTPKSFLEFIRLYQSLLERNGKEL
QAKVERLENGLLKLHSTSAQVDDLKAKLATQEVELRHKNEDTDKLIQVVGVETSKVSREK
AIADEEEQKVALIMLEVQQKQKDCEEDLAKAEPALTAAQAALNTLNKTNLTELKSFGSPP
LAVSNVSAAVMVLMAPGGKVPKDRSWKAAKITMAKVDSFLDSLIHFDKENIHENCLKAIR
PYLQDPAFNPEFVATKSYAAAGLCSWVINIVRFYEVFCDVEPKRQALNKATSDLTTAQEK
LAAIKAKITHLNENLAKLTTKFEKATAEKLKCQQEAELTAGTISLANRLVGGLASENIRW
AEAVQNFRQQERTLCGDILLTTAFISYLGFFTKKYRKSLMDGTWRPYLSQLKVPIPTTPT
LDPLRMLTDDAEVAAWQNEGLPADRMSMENATILINCERWPLMVDPQLQGIKWIKNKYGE
ELRVTQIGQKGCLQTIERALEAGDVVLIENLEESIDPVLGPLLGREVIKKGRFIKIGDKE
CEFNPKFRLILHTKLANPHYQPELQAQATLINFTVTRDGLEDQLLAAVVSMERPDLEQLK
SDLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGETALVENLEVTKQTAADVEEKVQEAK
LTEVKINEAREHYRPAAARASLLYFIMNDLSKIHPMYQFSLKAFSIVFQKAVEKAAPSES
VTERVTNLIDSITFSVYQYTTRGLFECDKLTYLAQLTFQILLVNQEVNAAELDFLLRAPV
QTGTPSPMEFLSHQAWGGIKALSSMEEFCNLDRDIEGSAKSWKKFVESECPEKEKFPQEW
KNKTALQRLCMMRAMRPDRMTYAMRDFVEEKLGSKYVMGRALDFVTSFEESGPATPMFFI
LSPGVDPLKDVENQGKKLGYTFNNRNFHNVSLGQGQEVVAEAALDLAAKKGHWVILQNIH
LVAKWLSTLEKKLEELSEESHPDFRVFISAEPAPSPEGHIIPQGILENSIKITNEPPTGM
HANLHKALDNFTQDTLEMCSRETEFKTILFALCYFHAVVAERRKFGPQGWNRSYPFNTGD
LTISVNVLYNFLEANTKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIRPEMLEG
ELSLAPGFPLPGNMDYSGYHQYIDAELPPESPYLYGLHPNAEIGFLTQTSEKLFRTVLEM
QPRDSQAGDGAGITREEKVKTFLEEILDRMTDEFNIAELMAKVEERTPYIVVALQECERM
NILTREIQRSLRELHLGLQGELTMTSEMENLQNALYLDVVPESWARRAYPSTAGLAAWFL
DLLNRIKELESWTGDFLMPSTVWLTGFFNPQSFLTAIMQSMARKNEWPLDQMALQCDVTK
KNREEFRSPPREGAYIYGLFMEGACWDTQTGIIAEAKLKDLTPPMPVMFLKAIPADKQDC
RSVYACPVYKTCQRGPTYVWTFNLKTKENPSKWVLAGVALLLQI
NT seq 13455 nt   +upstreamnt  +downstreamnt
atgcccggcgccaaggagcaggcagcgctggcggagtctggggacgaggagcctggagac
ccgaggctgcggcttctggggacttttgtggctcggagcctgcgtccggccgcgggcacc
tgggagcgctgtgcaggcacagccgaggcggggaggctgctgcaggccttcctggatcac
aacgctgcctcggatccgcggccactgctggtggttcagtccgggcccgggggcctggtg
gtgacacccggtctagacgcaggaccagagcccagccgagctcgcgccaaggggctcttt
ttcttgcgcactaagtccgagcctccgggaaatcacagcctccgcggcacggtgctctgc
ggggacctacccgcggtgccactggagcacctggccccgctgctctcagaggtcattatt
cctgtcctggcaaatgaaaagaaccatttagaatggccccacatggtatgtcaagacatc
agacatcatgcccacaccctgaagtctgacctcctagtgatctttgagcacatgaagggg
agaaccttgctgcctcttccagttggctcagaaaaactggagtttgtggatggccacagt
gagccagtctcagatgccatagacaagtcaactctctatgctgtggagtctgcagtgatc
aaatggagccaccaagtccaggtggtactcaagagggagtcttctcaggcactcatacaa
ggacaaaatcccacccccaaggtggagctggagttctggaagagcaggtgtgaggacctg
gaacacatttataatcaactaatgacaatcaaggtgaagggaatggctgaactcctggac
aaacttcagagcagctacttgccagctttcaaagccatgttcagagacgttgaagcagcc
ctgaccgaggcccaggacatccatgtgcacctgttacctctccagcaacacctggacatc
ctggaaaacgtggagtttcccaaggtgaagggcaggctgcggcctctgctccatgtggtc
tgtctgatttgggccacctgcaaatggtaccgttcccctgggaggctcacagtgctgctc
caagaaatctgcaacctcctcatccagcaggcctctaattacctcagcccagaagacctc
ctgagaagtgaggtggaagagagtcagaaaaaactgcaagtggtctcagataccttaagc
ttcttcaaacaggcattccaggacagaagggagcacctccacacttacttcaaggaggat
tctgaagtcagggtgtgggatttccaagcatctctggtgtttgtgcgactggatggcttt
ctgggccgagtgcacatggtggaggatcttctgaagacagccttggatctcaacaatctg
gaaaagcttgagttcagtggcctcagaggaaactccctgagtcagaaagtccaacgcatg
catgaggaatttgaggagatgtacaaggtcttcttggactgctcctatgactgtttggac
cccaagggcacggaatttgaaaatgatgtctgtgagtttaacaaaagagtggaagatctt
gaccggagactggggactatcttaattcaagcttttgatgatgcacctgatgtggaacat
gcctttaagctactggacatcacaggaaccctcatcaaaagacccctggtagcacaggat
gtatcacaaaaatacctggccctcatccgaatgttcagcacagaactggatgctgtgagg
gtcatctacagtcagcacatccagaaggaggcagagcatggattctcccccgtgcacaag
aacatgcccactatggctggcggcatctgctgggcacaggaactgaggcagcgcgtcaag
ggtccctttggcaacttcaaaaacataccacatctgtacttgcaatctgctgaaggaaag
cgaatgatacaaaaatacgaagacttgctctccctgctagaagagtatgagagaagactt
tatgaggactggtgtcagacggtatctgaaaagtcacagtacaatctttccctacctctt
ttgcatcgtgaccccaacacaaagcagctctctgtcaactttaacccacagctgatttca
gtgttgaaagaaatgaactatcttcagcccagtgaggtgaaaaccatccccgagaccgca
gcagccatgttctcctccagggaattctatcgtcagcttgtggccaacttggagttgatg
gcaaattggtacaacaaggttataaaaattctgctggaggtggaatttccactagtggag
gaagaactgcaaaatattgatctccgcctgagagctgcagaggagactctgagctggaaa
acagaaggcatttgggattatgctatgcaaataaccaatagcattcatgacctggaacaa
agaattcagaagacaaaagacaatgtggaagagattcaaaacatcatgaaaacatgggtg
tctccaatattcaagagaaaagatgggaaaaaagaatggcccctttctctggatgatcag
caggatcacatggaaaaatactacagtctcatccaggaatctggccttaagattcacgct
cttgttcaggaaaacctggttctgtttgcagcagacccagcatccagcatttggaagtct
tacgtgaactacattgattccatgttgttggatggattttttcttgccattgagtgttct
ctcaaatatctattggaaaacactgaatgcaagcctggactcaccccagtatttgaagca
cagctcaaccttgtcaccccagaattagttttccacccctctctggactctggggtaaag
ggaggcttatatgacattgtccagagtcttgtcaccagaatttttgctatgccatccctc
gtgccacggctttccccacacagtggctctcctcactatcagggtgacctagaggacatg
gccgacttagctggtcttcggagtgtgctcatggagagggtacagaatatgatgaccctc
tgctgtggctatagaaataccctcagccagtattcttacctgtatgtggaggataggaag
gagattcttggtcagtttctgctctatgggcatgtcctcacacctgaagagatagaagcc
catgccgaagacggcattccagaaaatccacccctcctccatcacttcaaagaccagata
gactcctatgaaaagctctatgaggaggtggtcagcctggaacccaccaaggtgtttgat
ggctggatgcgagtggatgtgagacccttcaaagcatctctgctgaacacaataaagaag
tggagcctcatgttcaagcaacatcttgttgactttgtcacaaacagcctgtctgacctt
gactcattcataaggagcaccgagagtggtttgctcaagagggtggagaaaggagatttc
caaggattggttgagatcatgggacatcttgtcacccttaaagaacggcagagcagcacc
gatgacatgtttgagcccctgaagcaaacgattgaactgctgaagtcctacgaacaagag
ctgccagaaaccgtgtttaagcaactggaggagcttcctgagaagtggaagaacatgaag
aagatggccatcactgtgaggcaacaggtggcccctctgcaggcaaatgaagtggcccta
ctccgccagcggtgctcagccttcgatgatgagcagcagcaattccaggagaggttccgc
aaagaggcccctttcaggtttgatagtatcaatccacaccaaatgctggatgcctggcac
gtggagatccagcacatggaatccaccatggcaaccatctctaagtcggctgatttgttt
gaagtcaatgttcctgactacaagcagctgaggcagtgcaggaaggaggcctgccagtta
aaggagctctgggacaccattggaatggtgacctccagcatccgtgcctgggaggccacc
agctggaggaatatcagtgtggaagccatggactcagagtgcaagcagttcgcccggcac
atccgcaacctagataaggagttcaggtcctgggatgcattcacgggcctggaaagcaca
gtgttgaacaccctgacgtccctgagggctgtggcggagctgcagaatcctgccatccgg
gatcggcactggaggcagctgatgcaggccaccggggtgaatttcaccatgaatcaggat
accaccttagctcatctcctgcagcttcagctccaccacttcgaggatgaggtccgaggc
attgtggacagagctgtcaaagagatgagtatggagaagaccttaaaggaattgcagact
acctgggccagcatggaattccagtacgagtcccacgcaagaacccgcgtacccttgctg
cagtcagatgaggatctcattgaggtcctagaggacaatcaagtgcaacttcagaacctg
atgatgtccaaatatgttgctttcttcctggaagaagtgtcgagctggcagaagaagctg
tccacggctgactcggtcatctctatctggtttgaggtgcagcgcacctggtctcaccta
gagagcatattcattggctcagaagatatccgggctcagctaccccaggactctaagaga
tttgaaggcattgactctgacttcagagagctggcgtatgatgctcagaaaaccccaaat
gtggtggaagccacaaataagtcaggtctctatgaaaagctggaggatatacaaagcaga
ttatgcctgtgtgagaaagccctagcagagtatctagacaccaagaggctcagcttccct
cgcttttacttcctgtcctcctctgacctgctggacatcctttccaatggcacagctcca
caacaggttcaacggcacctctccaagctctttgacaacatggctaagatgcagttccag
ttagatgccagtcagaacccaaccaagacgagccttggcatgtacagcaaagaggaggaa
tatgtggccttcagtgaggcctgtgactgcagtgggcaggttgaaatatggctgaaccgt
gttcttcgtcacatgaaagccactgtgaggcatgagatgacagagggggtcactgcctat
gaggaaaagcccagggatcagtggctgtttgattacccggctcaggtggctctgacctgc
actcagatctggtggacgacagaggtgggcattgcatttgccaggctggaggaaggctat
gagagtgccatgaaggactactataagaagcaagtggcccaactcaaaacccttatcacc
atgctaattgggccgctctccaagggggacaggcaaaagatcatgaccatatgcaccatc
gatgtgcatgcccgggatgtggtagccaagatgattgctcaaaaggttgacaatgcccag
gctttcctctggctgtcacagctacgacatcgttgggatgatgaggccaagcactgcttt
gctaacatctgtgacgcccagtttctatattcctatgagtacttgggaaatacacctcgc
ctagtgatcacgcctctgactgataggtgctacatcactctcacccagtctctacacttg
accatgagtggggctccagcaggacctgcaggcacaggcaagacagagaccaccaaggac
ctgggcagagcactcggcatcatggtctatgtgtttaactgttctgagcagatggactac
aagtcctgtggcaacatctacaaaggcctggctcagactggtgcctggggctgttttgat
gagtttaaccgaatctctgtggaggtcttgtcggtggtggctgtccaggtaaaaagcatc
caggatgcaatcagagacaagaagcagaggttcagcttccttggagaggagattagcctt
gacccttcagtgggcatcttcattaccatgaacccaggctatgctggccgcacagaactg
ccagagaacctcaaggcccttttcaggccctgtgcaatggtagttccagactttgagctg
atctctgagattatgctggtagcagaaggattcattgaagcccggttgttggccaggaag
ttcattaccctttaccggctgtgtaaagaacttctctccaaacaggatcactatgactgg
ggacttcgtgccattaagtctgtcctcgtggtagcaggatcactgaaacggggagaccct
gaccgcccagaggaccaagtcctgatgcgttctttgagagacttcaacatcccaaagatc
gtgacagatgacatgccggtgttcatgggtctgataggtgacctctttcctgctttggat
gtccccaggaagagagatctggactttgaggctgtggttcggaaagcaatcgtggacctt
aagctccaggctgaggacaactttgtgctcaaggtggtccagctggaggagctgctagct
gtaaggcactctgtgttcgtggtgggcggtgctggtaccgggaagtcacaggtactgagg
tctttacacaagacctatcagatcatgagacgtcgccctgtgtggactgacctcaacccc
aaagctgtcacaaatgatgaactctttggcatcatcaatccagccactcgagaatggaag
gatggactgttctcttccatcatgagagagcttgccatcatctctcatgatgggcccaag
tggatcttactggatggcgatatagacccgatgtggatagagtctctgaacacagtcatg
gatgataacaaggtactgaccctggcaagcaacgagagaatcccccttaaccccacaatg
cgtcttcttttcgagatcagccacctgcgcacagccacaccagcaaccgtctccagagca
gggatcctgtacataaaccctgcagacctgggatggaaccctccagtaagcagctggatt
gatcagagagaagtccagactgagagagccaacttgaccatcctgtttgacaaatatctt
cctacctgcttggacaccctcagaaccagatttaagaaaataattccagtcccagagcag
agtatgatccagatgctgtgctacctccttgagtgcctcctgacaaaggaggatatccct
gcagactgccccaaggaaatatatgaactctattttgtgtttgctgccatctgggcattt
ggcagtgctgtgatccaagatcagcttgtagactaccgggcagagttcagcaaatggtgg
ctgactgagtttaaaacagtcaagtttccttcccaaggaactgtctttgactactacata
gacccagagaccaagaaatttgagccctgggccaagctcatcccccagtttgaatttgac
ccagagatgcctttgcaggcttgtttggtacacacaagtgagaccatccgggtgtgctac
ttcatggagcggctcatgcaatggaggcggccggttatgctggttggccctgcaggctca
ggcaagtctgtgctggtgggagcaaagctgtccagccttaaccctgaggaatacatggtg
aaaaatgtgcccttcaactactatactacgtcagcaatgctgcaagctgtcttggagaaa
cctctagaaaagaaagctggcaggaattatggccctccaggcaacaggaaactcatctat
ttcatcgatgacatgaatatgcccgaggtggatgcctatggcacagtacagccccacact
gtcatcaggcagcacctagactatggccactggtatgatcggaacaagctgtctctgaag
gagatcatgaatgtacaatacatctcctgtatgaaccccactgcaggcagctttaccatc
aacccaaggcttcagcgccacttcagcgtgtttgccctctgcttcccaggagctgatgcc
ctctcttccatctatagcaccatcttgacccatcatctgaagtttggaaactttcccacc
accctgcagaaatccatccctcctctgataaacctggctgtcaccttccatcagaaaatt
gccaccacgtttctgcccacagcaatcaaatttcactacatcttcaatctcagagatttt
gccaatattttccaaggcattcttttctcctccgtggaatgtgtaaagtccacacaggac
ctagtgaaactctatctgcacgagtcaagtcgggtttatcgggataagatggtggaagaa
aaggatttcaatctttttgacaaaatccaaacagaattcctcaagaaaaattttgatgat
agtgaagaggtgctgaagcagacccagaacctgaacatgtattgtcactttgcaaatggc
attggtgagcccaagtacatgcctgtgcaatcatgggaccttctgaatcagactctggtg
gaagccctggagagccacaatgaagtgaatgctgtgatggacctagttctctttgaggat
gccatacgtcacatctgtcacatcaaccgaatcctggagtcccctcgaggaaatgccctg
ctagttggtgtaggtgggagtggtaagcagagtctgacaaagctggcagcttttatcagt
tccatggatgtattccagatcacccttcgcaaaggctaccaaatccctgacttcaaggtg
gacctggccagcctctgtctgaaagctggggtaaaaaatctcagtacagtgttccttatg
actgatgcccatgtggctgacgagaggttcctggtgctcatcaatgacctcctggcatct
ggtgagatcccagatctctactctgatgaggaagaggagaacatcataaacaatgtgaga
aatgaggtcaaaagccagggactcatggacagcagggagaactgctggaaattcttcata
gagagagtccagcgacaacttaaggtgactctctgtttctcccctgtggggaacaagctg
agaattcgaagcaggaagttcccagccattgtgaactgtactgctatcaactggttccat
gagtggcctcaggaggccctagagtctgtgagcctccgattcttgcagaatacaaagaac
attgagcctgcggtgaagcagtcaattagcaagttcatggcctttgtccacataagtgtc
aacaagacatcccagtcatacctgaccaatgagcagcgatacaactacacaacacccaag
tcctttctggagttcatcagactgtaccagagcttgctggagagaaatggaaaagagctc
caggccaaggtggagaggctggagaacgggctgttgaaactgcacagcacctcggcccag
gtggatgatctgaaagcgaagcttgccacccaggaagtggagctgaggcacaagaatgaa
gatacagacaagctgattcaggtggtgggtgtggagaccagcaaagtgagcagagagaaa
gccattgctgacgaggaggagcagaaggtggccctgatcatgctggaggtgcagcagaaa
cagaaagactgtgaagaggacctggctaaggccgagccagccctgaccgcagcgcaggcg
gccctcaacactctcaacaagaccaacctgacagagctgaagtcatttggttccccacct
ctggctgtcagcaatgtcagcgccgcggtgatggttctcatggccccagggggcaaggtg
cccaaggaccgcagctggaaggctgccaaaatcaccatggccaaggtggacagcttcctg
gattccctaatccacttcgacaaggagaacattcatgagaattgcctcaaagccatcagg
ccatacctgcaagatcctgcattcaacccagagtttgtggccaccaagtcctatgcagct
gcaggcctctgctcttgggtaatcaatattgtgaggttctatgaggtcttctgtgatgtg
gaaccaaagcgccaggctttgaacaaagccacctcagacctcacaactgcccaagagaag
ctggcagccatcaaagccaagatcacacaccttaatgaaaacctggcgaagctcaccacc
aagtttgagaaagcaacagcagagaagctcaagtgtcagcaagaagctgaactgaccgca
ggcaccatttcgcttgcaaaccgtctggttggaggccttgcatctgagaacataaggtgg
gcagaggctgtgcagaacttcagacagcaggaaaggacgttatgtggcgacattctgctt
actacagctttcatctcctacttgggcttctttaccaaaaagtaccgaaagagcctcatg
gatgggacctggagaccctatctgagccaactgaaagttcccattccaaccaccccaact
ctggaccccctgaggatgctaaccgatgatgctgaagtggctgcctggcagaatgagggt
ctccctgctgaccgcatgtccatggagaatgctaccatcctcatcaactgtgagcgctgg
cctctcatggtcgaccctcaactgcaaggcattaaatggatcaagaacaaatatggagaa
gaactccgggtcacccagattggccaaaagggctgccttcaaaccatagagcgagccctg
gaagctggagatgtggtactgattgagaaccttgaggagtccattgatcccgtcctggga
cctctgcttgggagagaagtcattaagaaaggacggtttatcaagattggagacaaggag
tgtgaattcaatcccaagttccggctcatccttcataccaagctggccaaccctcactac
cagcctgagctgcaggctcaggctaccctgatcaacttcacggtgaccagggatggcctg
gaggaccagctgctggctgctgtggtcagcatggagagaccagacctggaacagctgaag
tccgatctcacaaagcagcagaacgggttcaaaatcaccctcaaaaccttagaggacaac
ctgctatctcgcctctcttcagcctcggggaacttcctgggagaaacagccttggtggag
aacctggaggtcaccaagcagactgctgcagatgtggaggaaaaggtccaagaagccaaa
ttgacagaagtaaaaattaatgaggcccgagagcactataggccagcagctgcccgggca
tctctgctctacttcatcatgaatgacctcagcaagatccatccaatgtatcagttctcc
ctcaaggccttcagcattgtcttccagaaagctgtggagaaggcagctcccagtgaaagt
gtcacagagcgagtgactaatctaatagacagcataactttctcagtgtaccagtatacc
acacgtggcctctttgagtgtgataagctgacctacctagcccagctcacctttcagatt
ctcctcgtgaaccaggaagttaatgcagcagagttggatttcttgcttagggctccagta
cagacagggactcccagcccaatggagttcctgtcccaccaggcctggggaggcatcaag
gcactctcatcaatggaggaattctgcaatctggaccgagacattgaaggctctgccaag
agctggaaaaagtttgtggagtcagagtgtcccgagaaggagaagtttccccaggagtgg
aagaacaagacagccctgcagcgcctctgcatgatgagagccatgaggcctgaccggatg
acctatgccatgcgagattttgttgaggagaagttgggaagcaaatacgtgatgggaaga
gcactcgattttgtaacctcatttgaagagtcaggaccagccactcccatgtttttcatc
ctgtctccaggggtggatccactgaaggatgtggaaaatcaaggaaagaaacttggatat
acattcaacaatcggaacttccacaacgtgtccctagggcaaggacaagaggtagttgct
gaggctgcactggacttggctgctaagaagggtcactgggtgattctgcagaacatccac
ctggtggccaagtggctcagtaccctggagaagaaactggaggagctcagcgaggaaagt
cacccagacttcagggtcttcatcagcgcagagcctgcaccctcccctgagggccacatc
attccccagggcattctggaaaactccattaagatcaccaatgagcctcccacaggcatg
cacgccaacttacacaaagccctggacaacttcactcaggacactctggagatgtgttcc
cgggagacagagttcaagaccatcctctttgctttgtgctactttcatgcggtggttgcc
gagagacggaagtttgggccacagggctggaatcggtcctatccatttaacactggggac
ctcaccatctctgtgaatgtgctatataatttcctggaggctaacacaaaggtaccctat
gacgacttgcgttacctgttcggtgagatcatgtacggtggccatatcacagatgactgg
gacaggagactctgcagaacctatttagaggaattcattcggccagagatgctagaagga
gagctctccctggccccggggttcccactcccaggaaacatggactacagtggctatcac
cagtatattgatgctgagctgccccctgagtctccctacctatatggcctccatccaaac
gccgagattggcttcctgacccagacatcggaaaaactcttccgaaccgtgctggagatg
cagcctcgggacagccaggctggagatggagctggcatcacaagggaagaaaaggtcaaa
acctttctggaagaaatactggatcggatgacagatgaatttaacatcgcggagctaatg
gctaaggtggaggaacgcaccccctacattgtagttgccctccaggagtgtgaacgcatg
aacatccttaccagagagatccagcgctcactaagagagctgcatcttggcttacagggg
gagctgaccatgaccagtgagatggaaaacctacagaatgccctatatctagatgtggtc
ccagagtcctgggccaggcgagcctacccttccacagcaggcctggcagcctggtttcta
gacctgcttaacagaatcaaagagctggagtcctggacaggcgacttcttgatgccctca
actgtgtggctgacgggcttcttcaacccccagtccttcctgactgccatcatgcagtcc
atggcccgcaagaatgaatggccactagaccagatggccctgcagtgtgatgtgacaaag
aagaacagagaggagttccggagccctcctcgggaaggggcctacatctatgggctcttc
atggaaggtgcctgctgggacacacagactgggatcattgcagaggcgaaactgaaggac
ctgacaccccccatgcctgtgatgttcctcaaggccattccagcagataagcaagattgt
cgaagtgtctatgcttgtcctgtgtacaagacttgtcagcggggacccacctacgtgtgg
actttcaatctgaagactaaagaaaacccatccaagtgggttctggctggtgttgccttg
cttctccagatttaa

DBGET integrated database retrieval system