KEGG   Mus musculus (house mouse): 237823
Entry
237823            CDS       T01002                                 
Symbol
Pfas, 4432409B16Rik, FGAMS, FGAR-AT, FGARAT, Gm18, PURL, Sofa
Name
(RefSeq) phosphoribosylformylglycinamidine synthase (FGAR amidotransferase)
  KO
K01952  phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
Module
mmu_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    237823 (Pfas)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     237823 (Pfas)
SSDB
Motif
Pfam: GATase_5 AIRS_C FGAR-AT_N FGAR-AT_linker
Other DBs
NCBI-GeneID: 237823
NCBI-ProteinID: NP_001152991
MGI: 2684864
Ensembl: ENSMUSG00000020899
UniProt: Q5SUR0
Position
11:complement(68876527..68899286)
AA seq 1337 aa
MAPVLHFYVRPSGHEGAASGRVFRRLQEKLPTLQSVETELCYNVHWAAETLPWAEEMKKL
MWLFGCPLVRDDVAQEPWLVPGSNDLLLEVGPRLNFSTPASTNIVSVCQAAGLRAVDRVE
TTRRYRLSFTDHPTAEMEAISLAALHDRMTEQHYPDPIQSFSPQSIPAPLKGSIDILAEG
RPALEKANQELGLALDSWDLDFYTKRFQELQRNPSTVEVFDLAQSNSEHSRHWFFKGQLH
VDGKKLAHSLFESIMSTQASSNPNNVLKFCDNSSAIQGKKVKFLRPEDSTRPSCFQQQQG
LRHVVFTAETHNFPTGVAPFSGATTGTGGRIRDVQCTGRGAHVVAGTAGYCFGNLHIPDY
NLPWEDPSFQYPGNFARPLEVAIEASNGASDYGNKFGEPVLAGFARSLGLQLPDGQRREW
IKPIMFSGGIGSMEAKHVGKKPPEPGMEVVKVGGPVYRIGVGGGAASSVQVQGDNTSDLD
FGAVQRGDPEMEQKMNRVIRACVEAPGGNPICSLHDQGAGGNGNVLKELSDPEGAIIYTS
RFQLGDPTLNALEIWGAEYQESNALLLRPSDRDFLSRASARERCPACFVGTITGDKRIVL
VDDRECLVGKTGQGDAPLTPPTPVDLDLDWVLGKMPQKEFFLQRKPPVLQPLALPPELSV
RQALNRVLRLPAVASKRYLTNKVDRSVGGLVAQQQCVGPLQTPLADVAVVALSHQECIGA
ATALGEQPVKSLLDPKAAARLAVSEALTNLVFALVTDLRDVKCSGNWMWAAKLPGEGAAL
ADACEAMVAVMAALGVAVDGGKDSLSMAARVGTETVQAPGSLVISAYAVCPDITATVTPD
LKHPGGKGHLLYVPLSPGQHRLGGTALAQCFSQLGEHPPDLDLPENLVRAFHITQGLLKE
CRLCSGHDVSDGGLVTCLLEMAFAGNCGIEVDVPAPGIHALPVLFAEEPGLVLEVQEADV
AGVRQRYESAGLRCLELGHTGEAGPQAMARISVNKAVVVEEPVGELRALWEETSFQLDLL
QAEPRCVIEEKQGLKERTGPSYYLPPTFPVASVPCKPGGPVPRVAILREEGSNGDREMAD
AFHLAGFEVWDVTMQDLCSGAIRLDTFRGVAFVGGFSYADVLGSAKGWAAAVTFNPQARE
ELGRFRRRPDTFSLGVCNGCQLLALLGWVGSDPSEEQAEPGQDSQPTQPGLLLRHNLSGR
FESRWATVRVEPGPALMLRGMEGSVLPVWSAHGEGYMAFSSPELQAKIEAKGLVPLHWAD
DDGNPTEQYPLNPNGSPGGIAGICSQDGRHLALMPHPERAVRLWQWAWRPSPFDVLPTSP
WLQLFINARNWTQEDSC
NT seq 4014 nt   +upstreamnt  +downstreamnt
atggcccctgtccttcacttttatgtccgcccctctggccatgagggggcagcatctgga
cgtgtttttcggagactacaagagaaactgccaacacttcagagtgtggagactgagctg
tgctacaatgtacactgggcagctgagacccttccatgggctgaggagatgaagaagttg
atgtggctgttcggctgccctttggtgcgggatgatgttgctcaggagccctggcttgtt
cctggctccaacgatttgttgctggaggtgggacccaggctgaatttctcgactccagca
tcgaccaacattgtttctgtgtgccaggcagccgggctgagggctgtggatcgggtagag
accacccgacgttaccgactttcgtttaccgaccaccctacagctgaaatggaagccatc
tctctggccgccttgcacgaccggatgacagagcagcactaccctgaccccatccagagc
ttctctcctcagagcattccagccccactcaagggctccatcgacatactagctgagggt
cggcctgccctggagaaggccaaccaggagctaggtttggctcttgactcctgggacctc
gatttctataccaagcgctttcaagagctgcagcggaaccccagtacagtggaggtcttt
gacttggctcagtccaatagtgagcacagccgacattggttcttcaagggccagctccat
gtggatgggaagaagctagcgcattccctctttgaatccatcatgagcactcaggcatcc
tccaaccctaacaatgtcctcaagttctgtgacaacagcagtgcaatccaggggaagaaa
gtcaaattcctgcggccggaggactctacccgcccaagctgcttccagcaacagcagggg
cttagacatgttgtcttcacagcagagacacataacttccccacaggagtggcccccttc
agcggtgcaaccacaggcacgggtggccgcatcagagacgtccagtgcacaggccgtggg
gcccacgtggtagctggcactgctggctattgctttggaaacctgcacatcccagattat
aatctgccctgggaggacccaagcttccagtatcctgggaactttgccaggcctttggag
gttgctattgaggccagcaatggagcatctgactatggcaacaagtttggagagccagtg
ctggctggatttgcccgctctttgggtctccagcttccagatggtcagagacgtgagtgg
atcaagcccatcatgttcagtggcggcattgggtccatggaagccaaacatgtaggcaaa
aagcccccagagccaggcatggaggttgtaaaggttggaggtcctgtttataggattgga
gttgggggtggagctgcttcgtctgtgcaggtccagggagacaacaccagtgacctggac
tttggagctgtgcaacggggagacccggaaatggagcaaaagatgaatcgtgtgatccgg
gcttgtgtggaggccccaggaggaaaccccatctgcagcctccatgaccagggtgctggt
ggcaatggcaatgtcctaaaggagctgagtgacccagaaggagccatcatttacaccagc
cgcttccagctaggtgacccaaccttgaatgcactggaaatctggggggctgagtaccag
gagtcaaatgcactactgcttaggccctctgaccgggacttcctgagtcgtgccagtgcc
cgggaacgctgcccagcttgttttgtgggcacaatcactggagacaagagaattgtacta
gtggatgatcgtgaatgcctagtaggaaaaactggtcagggagatgcacccctgacacct
ccaacccctgtagacctggaccttgactgggtgctgggaaagatgcctcagaaggagttc
ttcctccagaggaaaccccctgtgctgcagcctttggctttgcccccagaactgagtgtg
cgacaggctctgaaccgggtcctaaggctgcctgctgtggccagcaaacgctacctcacc
aacaaggtggatcgctctgtgggtggccttgttgcccaacagcagtgtgtcggacccctg
cagactcctctggctgatgtggctgttgtagcactgagccaccaggagtgcataggggct
gccacagccctgggagagcagccagtcaagagcctgctggaccccaaggctgctgccagg
cttgctgtgtctgaggccctcaccaacctggtgtttgctctggtcaccgacctccgagat
gtgaagtgcagtgggaactggatgtgggcagccaagctcccaggtgagggtgcagcgctg
gctgatgcctgtgaggctatggtggcagtgatggcagcactgggtgtggcagtagatggt
ggcaaagactccctcagcatggctgcccgggtcggcactgagacggtgcaggctcctggg
tcactggtcatttcagcatatgctgtctgtccagacatcacagccactgtgaccccagac
ctcaaacatcctggtgggaaaggtcatttgctttatgtgcctttgagccccgggcagcac
cggctgggaggaacggctctagcccagtgtttctcccagcttggggagcaccctcctgat
ctagaccttcccgagaaccttgtgcgtgcctttcatatcacccaggggctgctgaaagaa
tgccgtctttgctcaggccatgatgtcagcgatggggggcttgtcacctgccttctagag
atggcctttgctgggaactgtgggatagaggtagatgtacctgcccctgggatccatgca
ttgcctgtgctgtttgcggaagagcccggtctggtgttggaggtacaggaggcagatgtg
gccggagtacggcagaggtacgagagtgctggcctacggtgtctggaactgggccacaca
ggcgaggctggaccccaggccatggcccgaatatcagtgaataaggctgtggtagtagag
gagcctgttggggagttaagagccctctgggaggaaacaagtttccagctggacctactg
caggcagagccacgctgtgtgatagaggagaaacagggcctgaaggagcggacagggccc
agctactacctgccgcccacctttcctgtggcctctgtgccctgtaaacctggtggaccc
gtccctcgagttgccatcttgcgagaagagggcagcaatggagaccgagaaatggctgat
gcctttcacttggcaggctttgaggtgtgggatgtgaccatgcaagatctctgctctggg
gccatcaggttggacacattccgtggtgtggcctttgtgggcggcttcagctacgcagac
gtcctgggctctgctaaaggttgggcagctgcggtgacctttaatccacaggccagggaa
gagctgggccgattccgaaggcggccggacaccttcagcctgggcgtgtgtaatggctgt
cagctgctggctcttctgggctgggtgggaagtgatcccagtgaagagcaagctgagcca
ggccaggactcccagccaacacagccgggcctcctgctccgccacaatctgtctgggcgg
ttcgagtcccgatgggccaccgtacgtgtggagccggggccagccctgatgctccgaggg
atggaaggctctgtgctgcccgtgtggagtgctcacggggaaggctacatggcattttct
tctcctgaactccaagccaagatcgaggccaagggcctggttcctctgcactgggcagac
gatgatgggaaccccacagagcagtaccctctgaaccccaatggatctccagggggcata
gctggtatctgttcccaagatggccgacacctggcactcatgccgcaccctgagcgggct
gtaaggctttggcagtgggcatggcgaccctctccctttgatgttcttcccacctccccg
tggctgcagctcttcatcaatgctaggaactggacccaggaggacagctgctga

DBGET integrated database retrieval system