KEGG   Mus musculus (mouse): 237868
Entry
237868            CDS       T01002                                 

Gene name
Sarm1, A830091I15Rik, C78606, MyD885, Sarm
Definition
(RefSeq) sterile alpha and HEAT/Armadillo motif containing 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SAM_2 SAM_1 TIR_2 SAM_3 SAM_PNT Carb_kinase Arm
Other DBs
NCBI-GeneID: 237868
NCBI-ProteinID: NP_766383
MGI: 2136419
Ensembl: ENSMUSG00000050132
Vega: OTTMUSG00000000147
UniProt: Q6PDS3
Position
11 B5; 11 46.74 cM
AA seq 724 aa
MVLTLLFSAYKLCRFFTMSGPRPGADRLTVPGPDRSGGASPWWAAGGRGSREVSPGVGTE
VQGALERSLPELQQALSELKQASAARAVGAGLAEVFQLVEEAWLLPAVGREVAQGLCDAI
RLDGGLDLLLRLLQAPELETRVQAARLLEQILVAENRDRVARIGLGVILNLAKEREPVEL
ARSVAGILEHMFKHSEETCQRLVAAGGLDAVLYWCRRTDPALLRHCALALANCALHGGQT
VQRCMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATNKEVEREVEHSGTLALVEPLV
ASLDPGRFARCLVDASDTSQGRGPDDLQSLVLLLDSSRLEAQCIGAFYLCAEAAIKSLQG
KTKVFSDIGAIQSLKRLVSYSTNGTTSALAKRALRLLGEEVPRRILPCVASWKEAEVQTW
LQQIGFSQYCENFREQQVDGDLLLRLTDEELQTDLGMKSSITRKRFFRELTELKTFASYA
TCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIRLGVHRTRILS
AAREMLHSPLPCTGGKLSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEA
GKFEDKLIQSVIAARNFVLVLSAGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGF
EWPEPQALPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRPSQDSSAGSDTSLEGATP
MGLP
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggtcctgacgctgctcttctccgcctacaaactgtgccgcttcttcaccatgtcaggc
ccacggccgggcgccgatcggctgacagtgcccggaccggatcggagtggtggcgccagc
ccatggtgggctgcgggcggtcgcgggtctcgcgaagtgtcgcccggagtgggcactgag
gtgcaaggcgccctggagcgttcgctgcctgagctgcagcaggcgctgtccgagctgaaa
caggcaagcgcggcgcgggctgtgggcgcgggtctcgccgaggtcttccagctggtagag
gaagcctggctgctgccggccgtgggccgcgaggtggcccaaggtctatgcgatgctata
cgtctggacggtggcctcgacttgctgttgcggctgcttcaggcaccggagctagagacc
cgtgtgcaggccgcgcgcttgctggagcagatcctggtggctgagaaccgggaccgcgtg
gcgcgcatcggtctaggcgtgatcttgaacctggcgaaggagcgcgagcctgtggaactg
gcacgaagcgtggcgggcatcttggagcacatgttcaagcactcggaggagacgtgccag
cggctggtggcggccggaggcctcgacgcggtgctgtactggtgccgccgcacagacccg
gcgctgctgcgccactgcgctcttgcgctggcgaactgcgcgctgcacgggggccagacg
gtgcagcggtgcatggtggagaagcgcgccgccgagtggctcttcccgctcgctttctcc
aaggaggacgagctgctgcggctgcacgcctgcctggcggtggcggtgttggctaccaac
aaggaggtggaacgcgaggtcgagcattctggcacattggcgcttgtcgagccgctcgtg
gcatcgctggaccccggccgcttcgcccgctgcctggtggatgccagtgacacaagccag
ggtcgtggaccagacgacctgcagagcctggtgctgttgctcgattcgtcgcgtttggag
gctcagtgcataggagcattctacctgtgcgcagaggctgccatcaagagcctacaggga
aagaccaaggtgttcagcgacatcggcgctatccagagcctgaaacgcctggtttcttac
tctacgaatggcaccacgtcggcgctggccaagcgcgcgctgcgcctattgggcgaggag
gtgccaaggcgcatcctgccctgcgtggccagctggaaggaagctgaggtccagacctgg
ctacagcagatcggcttctcccagtactgcgagaactttcgggagcagcaggtagatggt
gacctgcttctaagactcacagatgaagaactccagacagacctaggcatgaaatcaagc
atcacccgcaagaggttctttagggagctcacagagctcaagaccttcgccagctacgct
acttgcgaccgcagcaacctagcggactggctgggcagcctggatcctcgcttccgccag
tacacctatggcctggtcagctgcggtctggaccgctccctgctgcaccgcgtgtcagag
cagcagctcctggaggactgtggcatccgcctgggagtgcaccgcacgcgcatcctctct
gcagccagagaaatgctacattccccgctgccctgtactggaggcaagctcagtggggac
accccagatgtctttatcagttaccggaggaactcagggtcccagctggccagcctcctg
aaggtgcacctgcagcttcacggcttcagcgtcttcatcgacgtggagaagctggaagcc
ggcaaattcgaggacaagcttatccaaagcgtcatagcggctcgcaattttgtcctggtg
ctgtctgctggggcgctggataagtgcatgcaggaccatgactgcaaggactgggtgcac
aaggagattgtgactgctttaagctgtggcaagaacattgtgcccatcattgatggcttt
gagtggcctgagcctcaggcgctgcctgaggatatgcaggctgtactcaccttcaacggc
atcaaatggtcccatgagtaccaggaggccaccatcgagaagatcatccgcttcctacag
ggccgcccctctcaggactcctctgccggatcggataccagtttggagggagctacgcca
atgggtctgccttaa

DBGET integrated database retrieval system