KEGG   Mus musculus (mouse): 237911
Entry
237911            CDS       T01002                                 

Gene name
Brip1, 3110009N10Rik, 8030460J03Rik, BACH, Bach1, FACJ, Fancj, OF
Definition
(RefSeq) BRCA1 interacting protein C-terminal helicase 1
  KO
K15362  fanconi anemia group J protein [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03440  Homologous recombination
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    237911 (Brip1)
   03460 Fanconi anemia pathway
    237911 (Brip1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    237911 (Brip1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     237911 (Brip1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-B complex
     237911 (Brip1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     237911 (Brip1)
SSDB
Motif
Pfam: Helicase_C_2 DEAD_2 DEAD SNF2_N HBB DUF1866
Other DBs
NCBI-GeneID: 237911
NCBI-ProteinID: NP_840094
MGI: 2442836
Ensembl: ENSMUSG00000034329
Vega: OTTMUSG00000001045
UniProt: Q5SXJ3
Position
11; 11 C
AA seq 1174 aa
MSSVLSDYTIGGVKIHFPCRAYPAQLAMMNSIVRGLNSSQHCLLESPTGSGKSLALLCSA
LAWQQSLSEKPVDEGLNKKPEAPPSCSCACHSKNFTYSDTNLDTSPHFNSPSKPSSGRNG
VSTPCQDSPEKNTLAAKLSAKKQASIHRDEDDDFQVEKKRIRPLETTQQIRKRHCLEKDV
HHVDARLASEKRVKPESPIGKSFSDRKDSFQNVDGLCSRCCCSAKQGNNQEPANTVKKDH
GGQCKRPKIYFGTRTHKQIAQITRELRKTAYSGVPMTILSSRDHSCVHPEVVGNFNRKEK
CMELLDGKHGKSCYFYHGVHKISNQQTLQHLQGMSRAWDIEELVSLGRKLKACPYYTARE
LIEDADIVFCPYNYLLDSQIRETMDIKLKGQVVILDEAHNIEDCARESASYSVTEVQLRF
ARDELDSLINGNIRKKSHEPLRDVCYNLINWLETNSKHLVERGYESSCKIWSGNEMLLNL
YRMGITTATFPVLQRHLSAVLQKEEKVTPIHGKEEAIQIPIISASTQVVLKGLFMVLDYL
FRENSRFADDYKVAIQQTYSWTNQIAIFDKTGVLAVPKNKKHSRQKIGVNALNFWCLNPA
VAFSDINDKVRTIVLTSGTLSPLKSFSSELGVTFSIQLEANHVISNSQVWVGTVGSGPKG
RNLCATFQHTETFEFQDEVGMLLLSVCQTVSQGILCFLPSYKLLEKLRERWIFTGLWHSL
ESVKTVIAEPQGGEKTDFDELLQVYYDAIKFKGEKDGALLIAVCRGKVSEGLDFSDDNAR
AVITVGIPFPNVKDLQVELKRQYNDHHSKSRGLLPGRQWYEIQAYRALNQALGRCIRHKN
DWGALILVDDRFNNNPNRYISGLSKWVRQQIQHHSSFASALESLTEFSRRHQKVTNRSKK
DEKCTKDNEPTLEVACLEDSTFTSVSESSHQSPENSTEEAEVCVQELQCPQVATKSPSVA
SHGVSRRKKSDPGLRGESLQTMKTEKNEISRSSSPTFGKQTEPVNWPIFNSLRRHFNSKV
KNCTPVLKSSKNRAPGSSTFNKTALPLTGNCVPSNETADTSLGPCLQSEVIISPVKIEAT
PATNYSKQVFCCEKDLLPDTELSPGTEEAKCPSSNKAAETEVDDDSECFTPELFDPVDTN
EENGELVETDRSSHSSDCFSAEELFETATGFGQK
NT seq 3525 nt   +upstreamnt  +downstreamnt
atgtcctcagtgttgtctgactacaccatcggtggggtgaagatccactttccctgtaga
gcgtatccagcacagcttgcgatgatgaattctattgtcagaggactaaacagcagccaa
cactgtttgctggagagtcccacaggaagtggaaaaagtttagccttactttgttctgca
ttagcatggcagcaatctcttagtgagaagccagtggatgagggcctgaataaaaagcct
gaggcaccaccttcatgttcttgtgcatgccattcaaagaattttacctacagcgacaca
aacctggacacttcacctcatttcaatagtccaagcaaaccatcttctggaagaaatgga
gtctcaactccctgtcaagactctcctgaaaaaaatactctggctgcaaagttatctgcc
aagaaacaggcatctatacacagagacgaagatgatgattttcaggtagagaagaaaaga
atccgacccttagaaactacacagcagataagaaaacgtcattgtttggaaaaggacgtc
caccatgtagatgcacgactagcttcggaaaagagagtaaagcctgagtctccgatagga
aagtctttctccgacaggaaagactcttttcaaaatgtggatggcctttgttccaggtgc
tgctgttctgctaaacaaggaaacaaccaagagcctgcaaatactgttaagaaagatcac
gggggacaatgcaagagacctaaaatttattttgggacgcggacacacaagcagattgct
cagattaccagggagctccgtaagacagcttactcaggggtcccgatgactattctttcc
agcagggaccacagctgtgtccatcctgaagtggtggggaatttcaacagaaaggagaag
tgcatggagctgctggatggcaagcacgggaagtcctgctatttctatcatggtgttcat
aaaattagtaatcagcagacactgcagcaccttcagggcatgtccagagcctgggacata
gaagaactagtcagcctcgggaggaaactgaaagcttgtccctactatacagctcgagaa
ctgatagaggatgctgacatagtgttttgtccctacaactaccttttagactcacaaata
agggaaactatggatataaagctgaaaggacaagttgtcattttagatgaagctcacaac
attgaagactgtgctcgggaatcagcaagctacagtgtaaccgaagttcagcttaggttt
gctcgggatgagctagatagtttgatcaacggtaacataaggaagaaaagccacgagccc
ctacgagatgtgtgctataacctcatcaattggttagaaacaaattctaagcatcttgta
gaaaggggttatgagtcgtcttgtaaaatatggagtggaaatgagatgctcttaaactta
tacaggatgggcatcaccacggctacttttccagttttgcagaggcatctctcagctgtt
cttcaaaaagaagagaaagtcacaccaatccatggtaaagaggaggcaatacaaatccct
attatcagtgcatcaactcaagtcgtgctcaaaggactctttatggtgcttgactatctc
tttagagaaaatagcagatttgcagatgattataaagttgctattcaacagacttactcc
tggacaaatcagattgctatttttgataaaactggagtcttggctgtaccaaaaaataag
aaacattcacgacagaaaattggagttaatgcgctaaacttttggtgtttaaatccagct
gtggccttttcagatattaatgacaaagtacggaccattgttctaacatcaggaacactc
tcacccctgaaatccttttcatctgagcttggtgtcacatttagcatccaactggaggct
aaccatgtcatcagtaactcacaggtttgggttggtactgttggctcaggccctaagggt
cggaatctctgcgctacctttcagcatactgaaacatttgagttccaggatgaagtggga
atgcttctgttatctgtgtgccagactgtgagccaaggaattctgtgctttttgccatct
tacaagctattagagaaattaagagaacgttggattttcactggcctatggcatagtttg
gagtcagtgaagacagtcattgcagaaccccaaggaggagaaaaaactgattttgatgaa
ttgctgcaagtgtactatgacgccatcaagttcaaaggagaaaaggatggagcccttctc
atagcagtctgtcgtggcaaggtgagcgagggtctggatttctcagatgataacgcccgt
gctgtcataaccgtagggattcctttcccaaatgtgaaggatcttcaggtggagctaaaa
cgacaatacaatgaccaccactcaaaatcgagaggtcttctgcctggccgtcagtggtat
gaaattcaagcataccgagccttgaatcaggctctaggcagatgtattcggcacaaaaat
gattggggagctcttattctagtggacgatcgcttcaataacaatccaaaccgctatata
tcaggactttctaaatgggtgaggcagcagattcagcaccactcaagctttgcaagtgcc
ctggagtcgctgaccgagttctccagaagacaccagaaagttactaatagatccaaaaaa
gacgaaaaatgtacaaaagacaatgagcctactctggaagtggcctgtttggaggatagc
acttttacaagtgtgtcagaatcaagtcatcagtcaccagaaaactcgacagaagaagca
gaagtgtgtgtccaggagcttcagtgtccccaggtggctactaaaagcccctcagtagca
agccacggtgtttccagaaggaagaaaagtgatccaggactaagaggagagtctcttcag
acaatgaaaacagaaaaaaatgagatttcccgatcttcaagcccaacttttggaaagcaa
acagagccagtcaactggcctatctttaattctctaagacggcatttcaatagtaaagta
aaaaattgcacaccagtactcaagtcatcaaagaaccgtgcccctggttcttccactttc
aataaaactgctttgccactcacaggtaactgtgtgccctcaaacgaaacagcagacaca
tcactgggaccttgccttcagtcagaagtcataatttcaccagtgaagattgaagctact
cctgctacgaattattccaaacaggtgttctgctgtgagaaagacctactcccggatact
gaattgtcgccaggaactgaagaagccaagtgtcccagctcaaacaaagctgctgaaaca
gaagtggatgatgactctgagtgttttacacctgaactttttgatcctgtcgataccaac
gaagaaaacggtgaactggttgaaactgatagatcaagtcatagttcagattgtttttca
gcggaagagctttttgaaactgcaactggatttgggcagaagtga

DBGET integrated database retrieval system