KEGG   Mus musculus (mouse): 237943
Entry
237943            CDS       T01002                                 

Gene name
Gpatch8, 5430405G24Rik, AU018890, Fbm1, Gpatc8, mKIAA0553
Definition
(RefSeq) G patch domain containing 8
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: G-patch zf-C2H2_jaz zf-met G-patch_2
Other DBs
NCBI-GeneID: 237943
NCBI-ProteinID: NP_001152964
MGI: 1918667
Ensembl: ENSMUSG00000034621
Vega: OTTMUSG00000002856
UniProt: A2A6A1
Position
11; 11 D-E1
AA seq 1505 aa
MADRFSRFNEDRDFQGNHFDQYEEGHLEIEQASLDKPIESDNIGHRLLQKHGWKLGQGLG
KSLQGRTDPIPIVVKYDVMGMGRMEMELDYAEDATERRRVLEVEKEDTEELRQKYKDYVD
KEKAIAKALEDLRANFYCELCDKQYQKHQEFDNHINSYDHAHKQRLKDLKQREFARNVSS
RSRKDEKKQEKALRRLHELAEQRKQAECAPGSGPMFRPTTVAVDEDGGEEDKDESSTNSG
ASAVSSCGFGADFSTDKGGSFTSVQITNTTGLSQAPGLASQGISFGIKNNLGPPLQKLGV
SFSFAKKAPVKLESIASVFKDHAEEGSSEDGTKADEKSSDQGVQKVGDTDGTGNLDGKKE
DEDPQDGGSLASTLSKLKRMKREEGTGATEPEYYHYIPPAHCKVKPNFPFLLFMRASEQM
EGDHSAHSKSAPENRKSSSPKPQGCSKTAASPGAERTVSEASELQKEAAVAGPSEPGGKT
ETKKGSGGGEDEQSVESRETSESPMCESNPKDISQATPATKAGQGPKHPTGPFFPVLSKD
ESTALQWPSELLIFTKAEPSISYSCNPLYFDFKLSRNKDAKAKGTEKPKDVAGSSKDHLQ
SLDPREPNKSQEEEQDVVLSSEGRVDEPASGAACSSLNKQEPGGSHMSETEDTGRSHPSK
KEPSGKSHRHKKKKKHKKSSKHKRKHKADTEEKSSKAESGEKSKKRKKRKRKKNKSSAAA
DSERGPKSEPPGSGSPAPPRRRRRAQDDSQRRSLPAEEGNSGKKDDGGGGSSCQDHSGRK
HKGEPPTSSCQRRANTKHSSRSSHRSQPSSGDEDSDDASSHRLHQKSPSQYSEEEEEEEE
EEEEEDEDSGSEHSRSRSRSGHRHSSHRSSRRSYSSSSDASSDQSCYSRQHSYSDDSYSD
YSDRSRRHSKRSHDSDDSDYTSSKHRSKRHKYSSSDDDYSLSCSQSRSRSRSHTRERSRS
RGRSRSSSCSRSRSKRRSRSTTAHSWQRSRSYSRDRSRSTRSPSQRSGSRKGSWGHESPE
ERRSGRRDFIRSKIYRSQSPHYFQSGRGEGPGKKEDGRGDDSKGAGLPSQNSNTGTGRGS
ESDCSPEDKNSVTARLLLEKIQSRKVERKPNVCEEVLATPNKAGLKYKNPPQGYFGPKLP
PSLGNKPVLPMIGKLPATRKSNKKCEESGLERGEEQEHSEPEEGSPRSSDAPFGHQFSEE
AAGPLSDPPPEEPKSEEATADHSVAPLGTPAHTDCYPGDPAISHNYLPDPSDGDTLESLD
SGSQPGPVESSLLPIAPDLEHFPNYAPPSGEPSIESTDGTEDASLAPLESQPITFTPEEM
EKYSKLQQAAQQHIQQQLLAKQVKAFPASTALAPATPALQPIHIQQPATASATSITTVQH
AILQHHAAAAAAAIGIHPHPHPQPLAQVHHIPQPHLTPISLSHLTHSIIPGHPATFLASH
PIHIIPASAIHPGPFTFHPVPHAALYPTLLAPRPAAAAATALHLHPLLHPIFSGQDLQHP
PSHGT
NT seq 4518 nt   +upstreamnt  +downstreamnt
atggcggaccgcttctcccgcttcaacgaggaccgagactttcagggtaatcactttgat
cagtatgaagaaggacacttggagattgaacaagcatcccttgacaagcccatagaatcg
gataatattggacaccgcttactccagaaacatgggtggaagctgggccagggattggga
aaatctcttcaggggagaacagaccctattccaatcgttgtcaagtatgatgtcatgggc
atgggtcgaatggaaatggagctggattatgccgaggatgctaccgaacggcgtcgtgtc
ctagaagtagagaaagaagacacagaagagctgaggcagaagtacaaggattatgttgac
aaagaaaaggcaattgcaaaagccttggaagatctcagagccaacttttactgtgaactt
tgtgataaacagtatcagaaacatcaggaatttgacaaccacatcaattcttatgatcat
gcacacaagcagagattaaaagatctcaagcagagagagtttgcccgaaatgtctcttca
agatcccgcaaagacgagaagaaacaagaaaaagcccttcggcggctccatgagttggca
gagcaaagaaaacaagctgaatgtgcaccgggaagcgggcccatgttccgaccaaccacg
gtggctgtagacgaggatggtggagaagaggataaagatgagtcatcaaccaacagtggt
gcaagtgctgtttcttcttgtggctttggagccgacttctccacagataaagggggctcc
ttcacgtcagtacagatcactaataccactggactgtcacaggctcctggcttagcctcc
caaggtattagctttggcattaagaataatctgggacccccactgcagaaattgggagta
tcattttcctttgccaagaaagctcccgtcaaacttgaatcaatagcatccgttttcaag
gaccatgcagaggaagggagctcagaagatggaacgaaggctgatgagaagagctctgac
caaggggtgcagaaggtgggagatactgatggcactggtaatcttgatggaaagaaagaa
gatgaagaccctcaggatggagggtcccttgcctcaacactgtccaagttgaaaaggatg
aaacgggaagaaggaacaggggctacagagccagaatattaccactacatccccccagca
cactgcaaggtcaaacctaatttccccttcttactctttatgagagccagtgaacagatg
gaaggggatcatagtgcacactcaaagagtgcccccgagaacagaaaaagcagctctccc
aagccgcaaggctgtagtaagacagcagcaagcccaggggcagaaagaacagtgagtgaa
gcttctgagctgcaaaaggaagccgctgtggctgggccttcagagcctggaggtaaaact
gaaacaaagaaaggctccggaggaggggaagatgagcagagtgtagagagtagggagacg
tcagagagcccgatgtgtgagtccaatcctaaagacatttctcaggccaccccagcaaca
aaagcaggccagggacccaagcatcctactggtccattctttccagttttaagcaaggat
gaaagcactgccctccagtggccatcagaactactcattttcaccaaagcagagccttcc
atctcctacagttgtaatcctttatactttgactttaaactttcaagaaacaaagatgct
aaagctaaagggacagaaaagccaaaagatgtcgcaggctcctcaaaggatcatctccag
agccttgatcctagagaaccgaataaaagccaggaagaggagcaggatgtagtgctctct
tcagaaggcagagtggatgaacctgcatcaggggctgcctgtagcagcctgaacaagcag
gagcctgggggtagccatatgtcagaaactgaagacactgggagaagccatcctagcaag
aaagaaccatcaggcaagtctcacagacacaagaagaaaaagaaacacaaaaaatccagc
aagcacaaacgtaaacacaaggctgacacggaagagaagagttctaaggcagagtctggg
gagaaatctaagaagcgcaagaaacgaaaacggaagaagaacaaatcatcagccgcagct
gattctgaacgcggacccaaatcagaacctcctggaagcggcagcccggcaccaccgaga
aggcggcgccgagctcaagatgattcccagcggagatcccttcctgctgaagaaggaaac
agtggcaagaaggatgatggtgggggtggtagcagttgccaagatcacagtgggaggaaa
cacaaaggtgaaccaccaacttcctcctgccagcggagagctaacaccaaacatagcagc
cggtccagccatcggagccaacccagtagtggtgatgaggatagtgatgatgcttcctca
caccgactgcaccagaagtctccatcccagtacagtgaggaggaggaagaggaggaggag
gaagaagaggaggaagatgaagactccggtagtgagcattctcgtagccgctctcggtct
ggccatcgccattcctcacatcgttcctcccggcgctcttattctagcagctctgatgcc
tcttcagaccagagctgctatagtagacagcacagttactctgatgatagctatagtgac
tatagcgaccgatcacgaaggcactctaagcgctctcacgattcagatgattcagactat
accagctccaaacacaggtctaaacgacacaaatactcatcatctgatgatgactatagc
ctcagttgcagccagtcccgaagccgatctcggagtcatacaagggagcgatcaagatcc
cggggtcgaagccgcagtagcagctgtagtcgcagtcgaagcaagaggagaagtcgcagc
accacagcccacagctggcagcgaagccgaagctatagccgggaccggagccgcagcacc
aggagcccttctcagagatcaggctccagaaagggctcatggggtcatgagagcccagag
gaaaggcgctctggccgccgggatttcattcgttcaaagatctaccgctctcaatccccc
cactatttccaatcaggtcggggagaaggtcctggaaagaaagaagatggcagaggagat
gacagtaaaggagcaggcctgccctcccagaatagcaatactggcacaggaagggggtca
gaaagtgactgcagtcctgaagataagaattctgttactgccagactgctgctagagaag
atccagtccaggaaagtggagaggaaacccaatgtgtgcgaggaggtgctggccacccct
aataaggctgggctcaagtacaagaaccccccacaaggttactttgggcctaagctcccc
ccgtctcttggtaataagcctgttcttccaatgatagggaagcttccagctacccggaag
tccaataagaaatgtgaagagtctggcttagaaaggggagaagagcaggaacattcagag
ccagaagaagggtccccaaggagtagtgatgctccatttgggcatcagttctcagaggaa
gcagctggtcccttatcagaccctcccccagaagagccaaagtctgaagaagctactgct
gatcactctgtggctccgctaggcaccccagcccacactgactgctaccctggggatcca
gccatctcccataactacctcccggaccccagtgatggggatactctggagtctctggat
agtggcagtcaaccaggccctgtggaatccagcttgctgcctatagccccagaccttgag
cacttccccaattatgcacctcccagtggggaacctagtattgaatcaacagatgggact
gaggatgcctccttggctcctctcgagagccagcccatcaccttcacccctgaggagatg
gagaagtacagcaagctccagcaggctgcacagcagcacatccagcagcagcttctggcc
aaacaagtgaaggcctttccagcctccaccgccctagctccagccacaccagccctgcag
cccatccacattcagcagccagccacagcctctgccacctccatcaccactgttcagcat
gccatcctacagcatcatgctgcagccgctgctgccgccattggcattcaccctcacccc
caccctcagccgcttgctcaagtacatcatattccccagccccatctaacccctatttct
ttgtcccatctcactcactcaattatccctggccaccctgccacctttcttgctagccac
cctatccatataattcctgcctcagccatccatcctgggcccttcacctttcatcccgtc
ccacacgctgccctctaccccaccctgcttgccccacggcctgctgcagcagctgccaca
gccctccatcttcacccactgcttcaccccatcttctcaggtcaggacctgcagcaccct
cccagccatgggacttga

DBGET integrated database retrieval system