KEGG   Mus musculus (mouse): 23796Help
Entry
23796             CDS       T01002                                 

Gene name
Aplnr, APJ, Agtrl1, msr/apj
Definition
(RefSeq) apelin receptor
  KO
K04174  apelin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    23796 (Aplnr)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    23796 (Aplnr)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Gut peptide
   Apelin
    23796 (Aplnr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srv TAS2R
Motif
Other DBs
NCBI-GeneID: 23796
NCBI-ProteinID: NP_035914
MGI: 1346086
Ensembl: ENSMUSG00000044338
Vega: OTTMUSG00000013465
UniProt: Q9WV08
Position
2; 2 D
AA seq 377 aa AA seqDB search
MEDDGYNYYGADNQSECDYADWKPSGALIPAIYMLVFLLGTTGNGLVLWTVFRTSREKRR
SADIFIASLAVADLTFVVTLPLWATYTYREFDWPFGTFSCKLSSYLIFVNMYASVFCLTG
LSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAVPVMVFRSTDASENGTKIQCY
MDYSMVATSNSEWAWEVGLGVSSTAVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRK
RRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDIFLMNVFPYCTCISYVNS
CLNPFLYAFFDPRFRQACTSMLCCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGG
EQMHEKSIPYSQETLVD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgatggttacaactactatggggctgacaaccagtctgaatgcgactacgca
gactggaagccctctggagcgctcattcctgccatctacatgttggtttttcttctaggc
accacaggcaatggcctggtgctctggaccgtgtttcgaaccagccgcgaaaagagacgc
tcagctgacatcttcattgccagcctggcagtggctgacttgacctttgtggtgactttg
ccactgtgggccacttatacctaccgggagtttgactggccttttggaaccttctcttgc
aagctcagcagctacctcatctttgtcaacatgtacgccagtgtcttttgcctcaccggc
ctcagctttgaccgatacctggccattgtcaggccggtggccaatgctcggctaaggctg
cgagtcagcggggccgtggccacagcagtcttatgggtgctggctgcccttctagctgtg
cctgtcatggtgttccgttccacagacgcctcggaaaatggcaccaagatccagtgctac
atggactactctatggtggccacttcaaactcagagtgggcctgggaggtgggccttggg
gtgtcctccactgccgtgggctttgtggtgcccttcaccatcatgctgacatgttacttc
ttcattgcccaaaccatcgctggccatttccgaaaggagcgcattgagggcctgcggaag
aggcgccggctgctcagcattatcgtggtgcttgtagtgacctttgccctgtgctggatg
ccttaccacctggtgaagactctctacatgctgggcagtttgctgcactggccctgtgac
tttgacatcttcctcatgaatgtctttccgtactgcacctgcatcagttatgtcaacagc
tgcctcaacccctttctctatgccttctttgacccccgatttcgccaagcctgcacctcc
atgctctgctgtgatcagagcgggtgcaaaggcacccctcacagcagtagtgctgagaag
tcagccagttattcttccgggcacagccagggccctggccccaacatgggaaagggagga
gagcagatgcatgagaaatcgattccctatagtcaagaaacccttgtggactag

DBGET integrated database retrieval system