KEGG   Mus musculus (house mouse): 23796
Entry
23796             CDS       T01002                                 
Symbol
Aplnr, APJ, Agtrl1, msr/apj
Name
(RefSeq) apelin receptor
  KO
K04174  apelin receptor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    23796 (Aplnr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    23796 (Aplnr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    23796 (Aplnr)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Apelin
    23796 (Aplnr)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7tm_4 TAS2R TMEM70
Other DBs
NCBI-GeneID: 23796
NCBI-ProteinID: NP_035914
MGI: 1346086
Ensembl: ENSMUSG00000044338
UniProt: Q9WV08
Position
2:84966704..84970267
AA seq 377 aa
MEDDGYNYYGADNQSECDYADWKPSGALIPAIYMLVFLLGTTGNGLVLWTVFRTSREKRR
SADIFIASLAVADLTFVVTLPLWATYTYREFDWPFGTFSCKLSSYLIFVNMYASVFCLTG
LSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAVPVMVFRSTDASENGTKIQCY
MDYSMVATSNSEWAWEVGLGVSSTAVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRK
RRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDIFLMNVFPYCTCISYVNS
CLNPFLYAFFDPRFRQACTSMLCCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGG
EQMHEKSIPYSQETLVD
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggaagatgatggttacaactactatggggctgacaaccagtctgaatgcgactacgca
gactggaagccctctggagcgctcattcctgccatctacatgttggtttttcttctaggc
accacaggcaatggcctggtgctctggaccgtgtttcgaaccagccgcgaaaagagacgc
tcagctgacatcttcattgccagcctggcagtggctgacttgacctttgtggtgactttg
ccactgtgggccacttatacctaccgggagtttgactggccttttggaaccttctcttgc
aagctcagcagctacctcatctttgtcaacatgtacgccagtgtcttttgcctcaccggc
ctcagctttgaccgatacctggccattgtcaggccggtggccaatgctcggctaaggctg
cgagtcagcggggccgtggccacagcagtcttatgggtgctggctgcccttctagctgtg
cctgtcatggtgttccgttccacagacgcctcggaaaatggcaccaagatccagtgctac
atggactactctatggtggccacttcaaactcagagtgggcctgggaggtgggccttggg
gtgtcctccactgccgtgggctttgtggtgcccttcaccatcatgctgacatgttacttc
ttcattgcccaaaccatcgctggccatttccgaaaggagcgcattgagggcctgcggaag
aggcgccggctgctcagcattatcgtggtgcttgtagtgacctttgccctgtgctggatg
ccttaccacctggtgaagactctctacatgctgggcagtttgctgcactggccctgtgac
tttgacatcttcctcatgaatgtctttccgtactgcacctgcatcagttatgtcaacagc
tgcctcaacccctttctctatgccttctttgacccccgatttcgccaagcctgcacctcc
atgctctgctgtgatcagagcgggtgcaaaggcacccctcacagcagtagtgctgagaag
tcagccagttattcttccgggcacagccagggccctggccccaacatgggaaagggagga
gagcagatgcatgagaaatcgattccctatagtcaagaaacccttgtggactag

DBGET integrated database retrieval system