KEGG   Mus musculus (mouse): 23797Help
Entry
23797             CDS       T01002                                 

Gene name
Akt3, AI851531, D930002M15Rik, Nmf350
Definition
(RefSeq) thymoma viral proto-oncogene 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04370  VEGF signaling pathway
mmu04371  Apelin signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04620  Toll-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04668  TNF signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04910  Insulin signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04922  Glucagon signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04926  Relaxin signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04973  Carbohydrate digestion and absorption
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  HTLV-I infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05418  Fluid shear stress and atherosclerosis
Module
mmu_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    23797 (Akt3)
   04015 Rap1 signaling pathway
    23797 (Akt3)
   04010 MAPK signaling pathway
    23797 (Akt3)
   04012 ErbB signaling pathway
    23797 (Akt3)
   04370 VEGF signaling pathway
    23797 (Akt3)
   04371 Apelin signaling pathway
    23797 (Akt3)
   04630 Jak-STAT signaling pathway
    23797 (Akt3)
   04668 TNF signaling pathway
    23797 (Akt3)
   04066 HIF-1 signaling pathway
    23797 (Akt3)
   04068 FoxO signaling pathway
    23797 (Akt3)
   04072 Phospholipase D signaling pathway
    23797 (Akt3)
   04071 Sphingolipid signaling pathway
    23797 (Akt3)
   04024 cAMP signaling pathway
    23797 (Akt3)
   04022 cGMP - PKG signaling pathway
    23797 (Akt3)
   04151 PI3K-Akt signaling pathway
    23797 (Akt3)
   04152 AMPK signaling pathway
    23797 (Akt3)
   04150 mTOR signaling pathway
    23797 (Akt3)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    23797 (Akt3)
  Cell growth and death
   04210 Apoptosis
    23797 (Akt3)
   04218 Cellular senescence
    23797 (Akt3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    23797 (Akt3)
   04550 Signaling pathways regulating pluripotency of stem cells
    23797 (Akt3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    23797 (Akt3)
   04620 Toll-like receptor signaling pathway
    23797 (Akt3)
   04625 C-type lectin receptor signaling pathway
    23797 (Akt3)
   04660 T cell receptor signaling pathway
    23797 (Akt3)
   04662 B cell receptor signaling pathway
    23797 (Akt3)
   04664 Fc epsilon RI signaling pathway
    23797 (Akt3)
   04666 Fc gamma R-mediated phagocytosis
    23797 (Akt3)
   04062 Chemokine signaling pathway
    23797 (Akt3)
  Endocrine system
   04910 Insulin signaling pathway
    23797 (Akt3)
   04922 Glucagon signaling pathway
    23797 (Akt3)
   04923 Regulation of lipolysis in adipocyte
    23797 (Akt3)
   04920 Adipocytokine signaling pathway
    23797 (Akt3)
   04915 Estrogen signaling pathway
    23797 (Akt3)
   04914 Progesterone-mediated oocyte maturation
    23797 (Akt3)
   04917 Prolactin signaling pathway
    23797 (Akt3)
   04926 Relaxin signaling pathway
    23797 (Akt3)
   04919 Thyroid hormone signaling pathway
    23797 (Akt3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    23797 (Akt3)
  Digestive system
   04973 Carbohydrate digestion and absorption
    23797 (Akt3)
  Nervous system
   04725 Cholinergic synapse
    23797 (Akt3)
   04728 Dopaminergic synapse
    23797 (Akt3)
   04722 Neurotrophin signaling pathway
    23797 (Akt3)
  Development
   04380 Osteoclast differentiation
    23797 (Akt3)
  Aging
   04211 Longevity regulating pathway - mammal
    23797 (Akt3)
   04213 Longevity regulating pathway - multiple species
    23797 (Akt3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    23797 (Akt3)
   05230 Central carbon metabolism in cancer
    23797 (Akt3)
   05231 Choline metabolism in cancer
    23797 (Akt3)
   05205 Proteoglycans in cancer
    23797 (Akt3)
   05210 Colorectal cancer
    23797 (Akt3)
   05212 Pancreatic cancer
    23797 (Akt3)
   05225 Hepatocellular carcinoma
    23797 (Akt3)
   05226 Gastric cancer
    23797 (Akt3)
   05214 Glioma
    23797 (Akt3)
   05221 Acute myeloid leukemia
    23797 (Akt3)
   05220 Chronic myeloid leukemia
    23797 (Akt3)
   05218 Melanoma
    23797 (Akt3)
   05211 Renal cell carcinoma
    23797 (Akt3)
   05215 Prostate cancer
    23797 (Akt3)
   05213 Endometrial cancer
    23797 (Akt3)
   05224 Breast cancer
    23797 (Akt3)
   05222 Small cell lung cancer
    23797 (Akt3)
   05223 Non-small cell lung cancer
    23797 (Akt3)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    23797 (Akt3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    23797 (Akt3)
   04931 Insulin resistance
    23797 (Akt3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    23797 (Akt3)
  Infectious diseases
   05152 Tuberculosis
    23797 (Akt3)
   05166 HTLV-I infection
    23797 (Akt3)
   05162 Measles
    23797 (Akt3)
   05164 Influenza A
    23797 (Akt3)
   05161 Hepatitis B
    23797 (Akt3)
   05160 Hepatitis C
    23797 (Akt3)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    23797 (Akt3)
   05169 Epstein-Barr virus infection
    23797 (Akt3)
   05165 Human papillomavirus infection
    23797 (Akt3)
   05145 Toxoplasmosis
    23797 (Akt3)
   05142 Chagas disease (American trypanosomiasis)
    23797 (Akt3)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    23797 (Akt3)
   01524 Platinum drug resistance
    23797 (Akt3)
   01522 Endocrine resistance
    23797 (Akt3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23797 (Akt3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   23797 (Akt3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like FTA2 PH_11 APH
Motif
Other DBs
NCBI-GeneID: 23797
NCBI-ProteinID: NP_035915
MGI: 1345147
Ensembl: ENSMUSG00000019699
Vega: OTTMUSG00000020798
UniProt: Q9WUA6 Q8C6X4
Position
1; 1 H4
AA seq 479 aa AA seqDB search
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDDDGMDGMDNERRPHFPQFSYSASGRE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggctataaggag
aaacctcaagatgtggacttaccttatcccctcaacaacttctcagtggcaaaatgtcag
ttaatgaaaacagaacgaccaaagccaaatacatttattatcagatgtcttcagtggacc
actgttatagagagaacatttcatgtagatacaccagaggaaagagaagagtggacggaa
gctatccaagccgtagccgaccgattgcagaggcaagaggaggagaggatgaattgtagc
ccaacctcacagattgataatataggagaagaagagatggatgcgtctacaacccatcat
aaaagaaagacgatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatactatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactcttactgaaagcagagtacta
aagaacaccagacatccatttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatggcggagagctgtttttccatttgtcgagagag
cgagtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgctttggac
tatctacattctggaaagattgtgtaccgtgatctcaagttggagaatttgatgctagat
aaggatggccatataaaaattacggattttgggctttgcaaagaagggatcacagatgca
gctaccatgaagacattctgtggcacaccagagtacctggcaccagaggtattagaagat
aatgactatggccgagccgtggactggtggggcttaggtgttgtcatgtatgaaatgatg
tgtggaaggttgcctttctacaaccaggatcatgagaaactctttgaattaatactaatg
gaagacattaaattcccccgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggagggccagatgatgcaaaagaaatcatg
aggcatagttttttttctggagtaaactggcaagatgtatatgacaaaaagcttgtacct
ccttttaagcctcaagtaacatctgaaacagacacccgatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaagtatgacgacgacggcatggacggcatg
gacaacgagcggcggccacacttccctcagttctcctactctgcaagcggacgggaataa

DBGET integrated database retrieval system