KEGG   Mus musculus (mouse): 23802
Entry
23802             CDS       T01002                                 

Gene name
Amfr, gp7, gp78
Definition
(RefSeq) autocrine motility factor receptor
  KO
K10636  E3 ubiquitin-protein ligase AMFR [EC:2.3.2.36]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    23802 (Amfr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    23802 (Amfr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.36  RING-type E3 ubiquitin transferase (cysteine targeting)
     23802 (Amfr)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    23802 (Amfr)
  Multi subunit Ring-finger type E3
   ERAD complex
    23802 (Amfr)
SSDB
Motif
Pfam: G2BR zf-RING_2 zf-C3HC4_2 CUE zf-C3HC4 zf-RING_UBOX zf-C3HC4_3 zf-RING_11 zf-rbx1 zf-RING_5 zf-ANAPC11 Zn_ribbon_17 Prok-RING_4 zf-C3HC4_4 FANCL_C
Other DBs
NCBI-GeneID: 23802
NCBI-ProteinID: NP_035917
MGI: 1345634
Ensembl: ENSMUSG00000031751
Vega: OTTMUSG00000027363
UniProt: Q9R049 Q3TCI2
Position
8 C5; 8 45.96 cM
AA seq 639 aa
MPLLFLERFPWPSLRTYTGLSGLALLGTIVSAYRALSQPEDGSGEPEPLTAPLQPEARLT
AGGPRARDVAQYLLSDSLFVWVLVNTACCVLMLVAKLIQCIVFGPLRVSERQHLKDKFWN
FIFYKFIFIFGVLNVQTVEEVVMWCLWFAGLVFLHLMVQLCKDRFEYLSFSPTTPMSSHG
RVLSLLIAMLLSCCGLAVVCCVTGYTHGMHTLAFMAAESLLVTVRTAHVILRYVIHLWDL
NHEGTWEGKGTYVYYTDFVMELALLSLDLMHHIHMLLFGNIWLSMASLVIFMQLRYLFHE
VQRRIRRHKNYLRVVGNMEARFAVATPEELAVNNDDCAICWDSMQAARKLPCGHLFHNSC
LRSWLEQDTSCPTCRMSLNIADGSRAREDHQGENLDENLVPVAAAEGRPRLNQHNHFFHF
DGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDLQMTR
SVEITTDNILEGRIQVPFPTQRSDSLRPALNSPVERPSPDLEEGEASVQTERVPLDLSPR
LEETLDFSEVELEPIEVEDFEARGSRFSKSADERQRMLVQRKDDLLQQARKRFLNKSSED
DGASERLLPSEGTSSDPVTLRRRMLAAAAERRLQRQRTT
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgccgctgctcttcctcgagcgcttcccgtggcccagcctccgcacctacacgggcctc
agcggcctggccttgctgggcaccatcgtcagcgcctaccgcgccctcagtcagccggag
gacggctcgggtgagccggagccgctaacggccccactgcagcccgaggcgcgcctgacc
gccggcggcccccgggcccgcgacgtggcccagtacctgctgtcggacagcctgttcgtg
tgggttctggtgaatactgcttgctgtgttttgatgttggtggctaagcttatccagtgt
attgtgttcggccctcttcgagtgagtgaaagacagcatctcaaagacaagttttggaat
tttattttctacaagttcattttcatttttggagtgctgaatgtccagactgtggaggaa
gtggtgatgtggtgcctctggtttgctggacttgtcttcctgcatctgatggttcagctc
tgcaaagacagatttgaatacctttccttttctcccaccactccaatgagcagccatggg
agagtcctgtccctgctgattgctatgctgctctcctgctgtggactggcagtcgtctgc
tgtgtcacaggctacacacatggcatgcacaccttggctttcatggctgcagagtctctt
cttgtgaccgtgagaacagctcatgtgattttaagatatgtaattcacctctgggacctc
aaccacgaagggacgtgggaaggaaagggaacctatgtgtattacaccgactttgtcatg
gagctcgctctcctgtccctggacctcatgcaccacatccacatgctgttatttggcaac
atctggttatctatggctagcttggtcatctttatgcaacttcgttacctgttccatgag
gtacagcgtcgaatccgtcgacacaagaattatttgcgagtggtaggaaacatggaagcc
aggtttgctgttgcaactccagaggaactagctgtcaataatgatgactgtgcaatctgc
tgggactccatgcaggctgcaaggaaactgccctgtggacatctttttcacaactcctgc
cttcgttcttggctagaacaagacacctcttgtccaacatgcagaatgtctcttaatatt
gctgatggcagtcgtgccagggaagaccatcaaggagagaacctggacgagaacttggtt
cctgtagcagctgccgaaggcaggcctcgcttgaaccagcacaatcacttcttccacttc
gatgggtcccggattgcaagctggctgccaagtttttcagttgaagtgatgcacactacc
aacattcttggcatcacgcaggcaagcaactctcagctaaatgccatggctcatcagatt
caggagatgttccctcaggtcccgtaccaccttgtgctccaggacctccagatgacacgc
tccgtggagataacaacagataacatcttagaaggacggattcaagtacctttccccacg
cagcggtcggatagcctgaggcctgcactgaacagcccagtggagaggcccagccctgac
ctggaggagggagaagcttctgtccagacggagcgtgtaccactggacctcagtcctcgc
ctagaggagaccttggacttcagtgaggtagaactagagcctattgaggtggaagacttt
gaggcccgtggaagccgcttctccaagtctgctgatgagagacagcgcatgttagttcag
cgcaaggatgacctcctgcagcaggctcgaaagcggttcttaaacaaaagttctgaagat
gatggggcctcagagagactcctcccttctgaaggcacatcctctgaccccgtgaccctg
cgccgaaggatgctggcagccgctgctgagcggagacttcagaggcaacggacaacctag

DBGET integrated database retrieval system