KEGG   Mus musculus (house mouse): 238023
Entry
238023            CDS       T01002                                 
Symbol
Hexdc, Hexd
Name
(RefSeq) hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
  KO
K14459  hexosaminidase [EC:3.2.1.52]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00511  Other glycan degradation
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    238023 (Hexdc)
   00511 Other glycan degradation
    238023 (Hexdc)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     238023 (Hexdc)
SSDB
Motif
Pfam: Glyco_hydro_20
Other DBs
NCBI-GeneID: 238023
NCBI-ProteinID: NP_001001333
MGI: 3605542
Ensembl: ENSMUSG00000039307
UniProt: Q3U4H6
Position
11:121095187..121113485
AA seq 486 aa
MSSPTPFKMRLVHLDLKGAPPKVSYLSEVFPLFHALGANGLLIEYEDMFPYEGHLRLLRA
KHAYSPSEVTEILRLARLSELEVIPLVQTFGHMEFVLKHAAFAHLREVALFPNTLNPHEA
ESLALVQAMIDQILELHRDVRWLHIGCDEVYYLGEGETSKQWLQQEQNSHAKLCLSHMQA
VASHVLTQHPGVTPLVWDDMLRDIPQEQLKASGVPQLVEPVLWDYGADLDVHGKVFLIGK
YQECGFQRLWAASAFKGATGASQALPPVEHHIRNHELWLQVAGSGPKDALQGIILTGWQR
YDHFSVLCELLPVGIPSLAACLQSLVHGGFAEDVRLRAERFLGVSSLEIADTVSEGAGSF
PGSDIHALVTQISLHLRSSVDTLLERNRYVTGWFSPYHRRRKLVHPVMIQHIQPEALSLL
SRWNNLVQQLEVALQPVFYPDTIEEWLEENVLPSLQRLQDLLQDLGEAAARQPPPTSPGW
DTGQNP
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtcatcacccacgccatttaagatgagattagttcatttggaccttaaaggagcgccg
ccaaaggtttcatatctctctgaggtttttcccttgttccatgcacttggtgcaaatggc
ctcctcattgagtacgaagacatgtttccctatgagggccacctgaggctgctgagggcc
aagcatgcatacagcccgtccgaggttacagagatcctgcgcctggccagactcagtgag
ctggaagttatccccttggtgcagacattcggacacatggagtttgtgctaaagcatgca
gcatttgcacatctccgtgaagtggctctcttccccaacaccctgaaccctcacgaggct
gagtccctggccttggtacaagctatgatcgatcaaattctggagctacacagggatgtc
cggtggctccacattggctgtgacgaggtctactacttgggtgagggggaaacctcaaaa
cagtggctacagcaggaacagaacagccatgcgaaattgtgcctgagccacatgcaggca
gtagccagccatgtgctgacccagcaccctggcgtaacacccttggtgtgggatgacatg
ctacgggacatccctcaggaacagctaaaagcatctggggtgcctcaactggtggagcct
gtcctctgggactatggagctgacctggatgtccatggcaaagttttcctcataggaaag
taccaggagtgtggcttccagaggctgtgggctgccagtgccttcaagggggccacagga
gctagtcaggctctgccccctgttgagcaccacatcagaaaccatgagctgtggctgcag
gtggcaggcagtggaccaaaggatgctctacaaggaatcatcctgacgggctggcagagg
tacgaccacttctctgtgctgtgtgagctgcttccggtggggatcccatccctggctgcc
tgcctacagtcacttgtacatggaggctttgctgaggatgttaggctgagagcggaacgc
ttccttggggtttcaagcctggagatagcggatactgtaagtgagggagctggctccttc
cctggcagtgacatccatgccctcgtcacacaaattagtctccacctgcgcagctctgtg
gacacacttctggaaaggaacaggtatgtcactggctggttcagcccctaccatcgtaga
cggaagcttgttcacccagttatgatccagcacatacagccggaggcactcagccttcta
agtaggtggaacaacctcgtgcagcagttggaggtggccctgcagccggtcttctacccg
gacaccatagaggagtggctggaggagaatgtgctcccgagtctgcagcgactgcaggat
ctgctgcaggacctgggtgaggcggctgcccgacagccaccacccaccagcccaggctgg
gacacagggcagaacccctga

DBGET integrated database retrieval system